mRNA_Ecto-sp6_S_contig103.886.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig103.886.1 vs. uniprot
Match: R1CIT9_EMIHU (Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1CIT9_EMIHU) HSP 1 Score: 87.0 bits (214), Expect = 3.060e-20 Identity = 46/93 (49.46%), Postives = 56/93 (60.22%), Query Frame = 1 Query: 1 PKDHTVVCTKSGTCVIGRYKPFGGKTAHERLATAGNIKSPAIGASIKPGGKVALKSESVNREKHGKCDMAGTRLGEATRRRIEAGKVMSTKDY 279 PK TVVC CVIG YKP TAHERLA A + P + SIKP G+VAL+SES+NR CD AGT+LG+ ++ G V K+Y Sbjct: 3 PKSGTVVCDGE-KCVIGNYKPTKDGTAHERLAKAAGMDKPKVAGSIKPDGRVALRSESINRTNGLGCDAAGTKLGQWAEMKMALGDVEGVKEY 94 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig103.886.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig103.886.1 >prot_Ecto-sp6_S_contig103.886.1 ID=prot_Ecto-sp6_S_contig103.886.1|Name=mRNA_Ecto-sp6_S_contig103.886.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=99bp PKDHTVVCTKSGTCVIGRYKPFGGKTAHERLATAGNIKSPAIGASIKPGGback to top mRNA from alignment at Ecto-sp6_S_contig103:92670..93331- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig103.886.1 ID=mRNA_Ecto-sp6_S_contig103.886.1|Name=mRNA_Ecto-sp6_S_contig103.886.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=662bp|location=Sequence derived from alignment at Ecto-sp6_S_contig103:92670..93331- (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig103:92670..93331- >mRNA_Ecto-sp6_S_contig103.886.1 ID=mRNA_Ecto-sp6_S_contig103.886.1|Name=mRNA_Ecto-sp6_S_contig103.886.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=297bp|location=Sequence derived from alignment at Ecto-sp6_S_contig103:92670..93331- (Ectocarpus species6 EcLAC_371)back to top |