prot_Ecto-sp6_S_contig102.865.1 (polypeptide) Ectocarpus species6 EcLAC_371

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig102.865.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 22
ZOOM
x 1
POSITION
0
MMVQGFSSVFASAVCLLAASTSAFVVPSARVHALAPRAATTTTATSASALRTSARHSRRSALFMSEEAEEVAPEAPVAEQDPAQDATTSVKSFFAPNENVRLGSSRDQDGKSNVWAVEPKMRVEGTDVETPESNSLLVVGGIVGALVVAMSATIALLPSPDSM*20406080100120140160Expect = 2.94e-81 / Id = 86.83Expect = 1.39e-13 / Id = 48.81Expect = 1.40e-10 / Id = 47.83Expect = 6.20e-10 / Id = 51.43Expect = 9.55e-9 / Id = 49.28Expect = 5.07e-8 / Id = 52.46Expect = 7.59e-8 / Id = 45.31Expect = 9.73e-8 / Id = 46.15Expect = 5.36e-7 / Id = 44.78Expect = 1.05e-6 / Id = 47.46SequenceD7G979_ECTSIA0A836C6Z0_9STRAA0A835YKW3_9STRAA0A6V1QUM9_HETAKA0A7S2W9V8_9STRAA0A7S2BRW2_9STRAK0R0P9_THAOCB8LD08_THAPSA0A6U2FP18_9STRAA0A7S0AI54_9STRA
Match NameE-valueIdentityDescription
D7G979_ECTSI2.940e-8186.83Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2... [more]
A0A836C6Z0_9STRA1.390e-1348.81Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
A0A835YKW3_9STRA1.400e-1047.83Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
A0A6V1QUM9_HETAK6.200e-1051.43Hypothetical protein n=1 Tax=Heterosigma akashiwo ... [more]
A0A7S2W9V8_9STRA9.550e-949.28Hypothetical protein n=1 Tax=Rhizochromulina marin... [more]
A0A7S2BRW2_9STRA5.070e-852.46Hypothetical protein n=1 Tax=Florenciella parvula ... [more]
K0R0P9_THAOC7.590e-845.31Uncharacterized protein n=1 Tax=Thalassiosira ocea... [more]
B8LD08_THAPS9.730e-846.15Predicted protein n=1 Tax=Thalassiosira pseudonana... [more]
A0A6U2FP18_9STRA5.360e-744.78Hypothetical protein n=1 Tax=Pseudictyota dubia Ta... [more]
A0A7S0AI54_9STRA1.050e-647.46Hypothetical protein n=1 Tax=Minutocellus polymorp... [more]

Pages

back to top