prot_Ecto-sp6_S_contig101.802.1 (polypeptide) Ectocarpus species6 EcLAC_371

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig101.802.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 15
ZOOM
x 1
POSITION
0
MLFGFNLLWKLFKAGLLATNAVTILHKQRFLRKYRLDEVDHSPSASAMKNQVVGLIAAVAYLRGPLIVLNSLTCVIAMLP*1020304050607080Expect = 3.40e-47 / Id = 100.00Expect = 6.35e-20 / Id = 62.50Expect = 1.64e-15 / Id = 54.17Expect = 1.04e-13 / Id = 55.22Expect = 1.56e-13 / Id = 47.95Expect = 6.00e-13 / Id = 53.03Expect = 1.71e-12 / Id = 52.24Expect = 2.29e-10 / Id = 46.58Expect = 3.25e-10 / Id = 47.76Expect = 5.90e-9 / Id = 44.59SequenceD7FPN5_ECTSIA0A835YX81_9STRAK8ZAA6_NANGCA0A2D4BY06_PYTINA0A067C849_SAPPCA0A8K1FQA8_PYTOLA0A3F2RI45_9STRAK3WSH3_GLOUDA0A0P1A8P8_PLAHLG4ZTT8_PHYSP
Match NameE-valueIdentityDescription
D7FPN5_ECTSI3.400e-47100.00Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2... [more]
A0A835YX81_9STRA6.350e-2062.50Yos1-like protein n=1 Tax=Tribonema minus TaxID=30... [more]
K8ZAA6_NANGC1.640e-1554.17Uncharacterized protein n=2 Tax=Monodopsidaceae Ta... [more]
A0A2D4BY06_PYTIN1.040e-1355.22Uncharacterized protein n=1 Tax=Pythium insidiosum... [more]
A0A067C849_SAPPC1.560e-1347.95Uncharacterized protein n=3 Tax=Saprolegniaceae Ta... [more]
A0A8K1FQA8_PYTOL6.000e-1353.03Uncharacterized protein n=1 Tax=Pythium oligandrum... [more]
A0A3F2RI45_9STRA1.710e-1252.24Uncharacterized protein n=2 Tax=Phytophthora kerno... [more]
K3WSH3_GLOUD2.290e-1046.58Uncharacterized protein n=2 Tax=Pythiaceae TaxID=4... [more]
A0A0P1A8P8_PLAHL3.250e-1047.76Immediate early response 3-interacting protein 1-l... [more]
G4ZTT8_PHYSP5.900e-944.59AP-3 complex subunit delta n=21 Tax=Phytophthora T... [more]

Pages

back to top