prot_Ecto-sp6_S_contig100.707.1 (polypeptide) Ectocarpus species6 EcLAC_371

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig100.707.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MAASIQELQGKLVSVITGDGRQILGNLKGYDHTINLVLEGCKERIYSQSRGVEQARETGTYSSMVQLGLYICRGDNIAVIGEVDEVEDASKDLSRIRAEPLKPVTH*102030405060708090100Expect = 2.49e-50 / Id = 96.47Expect = 6.07e-35 / Id = 55.66Expect = 5.95e-33 / Id = 57.69Expect = 9.55e-32 / Id = 54.72Expect = 1.92e-31 / Id = 55.66Expect = 3.88e-31 / Id = 53.77Expect = 3.88e-31 / Id = 54.72Expect = 7.82e-31 / Id = 50.00Expect = 7.82e-31 / Id = 56.60Expect = 1.08e-30 / Id = 52.83SequenceD7FKG9_ECTSIA0A835ZJ72_9STRAA0A5S6R3V4_TRIMRA0A7I8VGN1_9ANNEA0A6P6YHQ5_DERPTA0A8B7Z2R1_ACAPLUPI0014259F6AH2XL05_CIOINUPI0006B0C9FCA0A7R9Y9D5_9STRA
Match NameE-valueIdentityDescription
D7FKG9_ECTSI2.490e-5096.47U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=E... [more]
A0A835ZJ72_9STRA6.070e-3555.66U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=T... [more]
A0A5S6R3V4_TRIMR5.950e-3357.69U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=T... [more]
A0A7I8VGN1_9ANNE9.550e-3254.72U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=D... [more]
A0A6P6YHQ5_DERPT1.920e-3155.66U6 snRNA-associated Sm-like protein LSm8 n=2 Tax=P... [more]
A0A8B7Z2R1_ACAPL3.880e-3153.77U6 snRNA-associated Sm-like protein LSm8 n=2 Tax=A... [more]
UPI0014259F6A3.880e-3154.72U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=A... [more]
H2XL05_CIOIN7.820e-3150.00U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=C... [more]
UPI0006B0C9FC7.820e-3156.60U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=L... [more]
A0A7R9Y9D5_9STRA1.080e-3052.83U6 snRNA-associated Sm-like protein LSm8 n=1 Tax=P... [more]

Pages

back to top