mRNA_Ecto-sp6_S_contig105.1015.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5KBR5_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBR5_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 1.250e-14 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 65 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 98
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5JCY6_9PHAE (Reverse transcriptase domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCY6_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 3.120e-14 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 45 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 78
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5K1X6_9PHAE (Reverse transcriptase domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1X6_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 3.860e-14 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 65 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 98
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5JUC0_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUC0_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 5.870e-14 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 29 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 62
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5JHV5_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHV5_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 7.320e-14 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 45 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 78
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5L732_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L732_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 7.590e-14 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 76 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 109
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5JRX8_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRX8_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 1.790e-13 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 65 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 98
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5JVE1_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVE1_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 2.990e-13 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 160 RVRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 193
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5JHY6_9PHAE (Reverse transcriptase domain-containing protein (Fragment) n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHY6_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 3.370e-13 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 2 Query: 146 VRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 VRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 66 VRMDDGELSDWFFVTQGVRQGCVLSPLLFNIFF 98
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Match: A0A6H5JVL0_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVL0_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 3.520e-13 Identity = 33/34 (97.06%), Postives = 33/34 (97.06%), Query Frame = 2 Query: 143 RVRMDDGELSDWFFVTQGGRQGCVLSPLLFNIFF 244 RVRMDDGELSDWFFVTQG RQGCVLSPLLFNIFF Sbjct: 268 RVRMDDGELSDWFFVTQGERQGCVLSPLLFNIFF 301 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig105.1015.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig105.1015.1 >prot_Ecto-sp6_S_contig105.1015.1 ID=prot_Ecto-sp6_S_contig105.1015.1|Name=mRNA_Ecto-sp6_S_contig105.1015.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=82bp MGSMSRFRISSTRGTVGPLLPVINDDRINSCLTCITLIKREESSVDTPGAback to top mRNA from alignment at Ecto-sp6_S_contig105:508865..509980- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig105.1015.1 ID=mRNA_Ecto-sp6_S_contig105.1015.1|Name=mRNA_Ecto-sp6_S_contig105.1015.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=1116bp|location=Sequence derived from alignment at Ecto-sp6_S_contig105:508865..509980- (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig105:508865..509980- >mRNA_Ecto-sp6_S_contig105.1015.1 ID=mRNA_Ecto-sp6_S_contig105.1015.1|Name=mRNA_Ecto-sp6_S_contig105.1015.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=246bp|location=Sequence derived from alignment at Ecto-sp6_S_contig105:508865..509980- (Ectocarpus species6 EcLAC_371)back to top |