mRNA_Ecto-sp6_S_contig100.755.1 (mRNA) Ectocarpus species6 EcLAC_371
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Homology
BLAST of mRNA_Ecto-sp6_S_contig100.755.1 vs. uniprot
Match: D7FRL7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRL7_ECTSI) HSP 1 Score: 89.7 bits (221), Expect = 2.270e-21 Identity = 40/43 (93.02%), Postives = 41/43 (95.35%), Query Frame = 2 Query: 275 MATWYTIFFAFKACGMRRVTRP*TPGGGREHHASHRRLRFVKP 403
MATW TIFFAFKACGMRRVTRP TPGGGREHHASHRRLRF+KP
Sbjct: 1 MATWCTIFFAFKACGMRRVTRPWTPGGGREHHASHRRLRFLKP 43 The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp6_S_contig100.755.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_Ecto-sp6_S_contig100.755.1 >prot_Ecto-sp6_S_contig100.755.1 ID=prot_Ecto-sp6_S_contig100.755.1|Name=mRNA_Ecto-sp6_S_contig100.755.1|organism=Ectocarpus species6 EcLAC_371|type=polypeptide|length=60bp MTINRKEKTKRTRTAGDDIAEIPPYAVTCALGERGVRVGGGSGQCRLALPback to top mRNA from alignment at Ecto-sp6_S_contig100:522355..522789- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_Ecto-sp6_S_contig100.755.1 ID=mRNA_Ecto-sp6_S_contig100.755.1|Name=mRNA_Ecto-sp6_S_contig100.755.1|organism=Ectocarpus species6 EcLAC_371|type=mRNA|length=435bp|location=Sequence derived from alignment at Ecto-sp6_S_contig100:522355..522789- (Ectocarpus species6 EcLAC_371)back to top Coding sequence (CDS) from alignment at Ecto-sp6_S_contig100:522355..522789- >mRNA_Ecto-sp6_S_contig100.755.1 ID=mRNA_Ecto-sp6_S_contig100.755.1|Name=mRNA_Ecto-sp6_S_contig100.755.1|organism=Ectocarpus species6 EcLAC_371|type=CDS|length=180bp|location=Sequence derived from alignment at Ecto-sp6_S_contig100:522355..522789- (Ectocarpus species6 EcLAC_371)back to top |