prot_Ecto-sp13_S_contig101167.148.1 (polypeptide) Ectocarpus species13 EcNAP12_S_4_19m

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_Ecto-sp13_S_contig101167.148.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 14
ZOOM
x 1
POSITION
0
KVSELKAELASRSLDVKGNKADLAQRLQAALDEEEFGAISMPTPTAGDAATEV5101520253035404550Expect = 1.23e-22 / Id = 98.08Expect = 3.12e-21 / Id = 96.15Expect = 9.55e-7 / Id = 63.27Expect = 1.58e-6 / Id = 62.22Expect = 3.29e-6 / Id = 75.68Expect = 1.11e-5 / Id = 58.00Expect = 2.08e-5 / Id = 60.00Expect = 2.12e-5 / Id = 70.27Expect = 2.33e-5 / Id = 54.72Expect = 3.64e-5 / Id = 61.36SequenceA0A6H5KM35_9PHAED8LQC6_ECTSIUPI0006D4CA98B7G614_PHATCA0A835Z395_9STRAA0A7S3PZ56_9STRAA0A7S1D3T5_CYCTEA0A7S3HLW8_9STRAA0A425D5Z6_9STRAA0A8B9C943_9AVES
Match NameE-valueIdentityDescription
A0A6H5KM35_9PHAE1.230e-2298.08SAP domain-containing protein n=1 Tax=Ectocarpus s... [more]
D8LQC6_ECTSI3.120e-2196.15SAP domain-containing protein n=2 Tax=Ectocarpus T... [more]
UPI0006D4CA989.550e-763.27heterogeneous nuclear ribonucleoprotein U-like pro... [more]
B7G614_PHATC1.580e-662.22Predicted protein n=1 Tax=Phaeodactylum tricornutu... [more]
A0A835Z395_9STRA3.290e-675.68SAP domain-containing protein n=1 Tax=Tribonema mi... [more]
A0A7S3PZ56_9STRA1.110e-558.00Hypothetical protein n=2 Tax=Chaetoceros debilis T... [more]
A0A7S1D3T5_CYCTE2.080e-560.00Hypothetical protein n=2 Tax=Cyclophora tenuis Tax... [more]
A0A7S3HLW8_9STRA2.120e-570.27Hypothetical protein n=1 Tax=Spumella elongata Tax... [more]
A0A425D5Z6_9STRA2.330e-554.72SAP domain-containing protein n=7 Tax=Aphanomyces ... [more]
A0A8B9C943_9AVES3.640e-561.36SAP domain-containing protein n=2 Tax=Galloanserae... [more]

Pages

back to top