prot_E-siliculosus-1a_M_contig944.17464.1 (polypeptide) Ectocarpus siliculosus Ec864m_EcPH12_78m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_M_contig944.17464.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a male vs UniRef90)
Total hits: 12
ZOOM
x 1
POSITION
0
YAALAIVSNCYSPPKGKFSRVTHPSATKVLTLSYDLHV*5101520253035Expect = 8.82e-13 / Id = 73.68Expect = 1.35e-6 / Id = 77.78Expect = 4.24e-6 / Id = 77.78Expect = 2.97e-5 / Id = 52.38Expect = 3.74e-5 / Id = 74.07Expect = 3.90e-5 / Id = 74.07Expect = 4.99e-5 / Id = 77.78Expect = 5.02e-5 / Id = 74.07Expect = 5.10e-5 / Id = 74.07Expect = 6.27e-5 / Id = 74.07SequenceA0A2Z4HGD5_9EUKAA0A7J6EN31_CANSAA0A4D6NK66_VIGUNA0A803Q5Q2_CANSAA0A5D2EN24_GOSDAA0A8J5YAY6_9ROSIG7LHI8_MEDTRA0A2U1PNS7_ARTANA0A445DVN7_ARAHYA0A0V0HD12_SOLCH
Match NameE-valueIdentityDescription
A0A2Z4HGD5_9EUKA8.820e-1373.68Uncharacterized protein n=1 Tax=Cyanophora sudae T... [more]
A0A7J6EN31_CANSA1.350e-677.78Uncharacterized protein (Fragment) n=1 Tax=Cannabi... [more]
A0A4D6NK66_VIGUN4.240e-677.78Uncharacterized protein n=1 Tax=Vigna unguiculata ... [more]
A0A803Q5Q2_CANSA2.970e-552.38Reverse transcriptase domain-containing protein n=... [more]
A0A5D2EN24_GOSDA3.740e-574.07Uncharacterized protein (Fragment) n=1 Tax=Gossypi... [more]
A0A8J5YAY6_9ROSI3.900e-574.07Uncharacterized protein n=1 Tax=Gossypium anomalum... [more]
G7LHI8_MEDTR4.990e-577.78Uncharacterized protein n=1 Tax=Medicago truncatul... [more]
A0A2U1PNS7_ARTAN5.020e-574.07Uncharacterized protein n=1 Tax=Artemisia annua Ta... [more]
A0A445DVN7_ARAHY5.100e-574.07Uncharacterized protein n=1 Tax=Arachis hypogaea T... [more]
A0A0V0HD12_SOLCH6.270e-574.07Putative ovule protein n=3 Tax=Pentapetalae TaxID=... [more]

Pages

back to top