prot_E-siliculosus-1a_F_contig10134.142.1 (polypeptide) Ectocarpus siliculosus Ec863f_EcPH12_90f female

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10134.142.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MLAKEDKNNFVSFNKIKSDPLVTKMTNLLMRHGKRSKAEKILFKALQALDKIYPGQATHIFYLAIIAAKQDIAVRIKPKPKKRRNKQSFNVYLPRVISPTCGLSLGMRSILKISRERSQLSLLPLWESLSQELLQASQSKGKVVEKRYKVNKLAISNKRKVHFAIYR*20406080100120140160Expect = 7.27e-99 / Id = 92.12Expect = 3.64e-76 / Id = 74.25Expect = 2.03e-75 / Id = 74.25Expect = 6.55e-74 / Id = 72.15Expect = 2.62e-71 / Id = 71.86Expect = 3.60e-71 / Id = 70.81Expect = 1.10e-70 / Id = 74.51Expect = 1.37e-70 / Id = 70.81Expect = 1.56e-70 / Id = 70.12Expect = 6.71e-70 / Id = 69.57SequenceE6ZER1_ECTSIA0A0U1XGE3_9PHAEA0A089N0X3_PETFAQ94Z12_PYLLIA0A0U1V7B7_SCYLOA0A8E8U536_ALAESA0A3G5FPM3_9PHAEA0A2H4ZR10_9PHAEA0A1I9LW96_9PHAEA0A8F0JZY2_AKKLU
Match NameE-valueIdentityDescription
E6ZER1_ECTSI7.270e-9992.12Ribosomal protein S7 n=2 Tax=Ectocarpus siliculosu... [more]
A0A0U1XGE3_9PHAE3.640e-7674.25Ribosomal protein S7 n=1 Tax=Colpomenia peregrina ... [more]
A0A089N0X3_PETFA2.030e-7574.25Ribosomal protein S7 n=1 Tax=Petalonia fascia TaxI... [more]
Q94Z12_PYLLI6.550e-7472.15Ribosomal protein S7 n=1 Tax=Pylaiella littoralis ... [more]
A0A0U1V7B7_SCYLO2.620e-7171.86Ribosomal protein S7 n=1 Tax=Scytosiphon lomentari... [more]
A0A8E8U536_ALAES3.600e-7170.81Ribosomal protein S7 n=8 Tax=Alariaceae TaxID=2887... [more]
A0A3G5FPM3_9PHAE1.100e-7074.51Ribosomal protein S7 n=1 Tax=Cladosiphon okamuranu... [more]
A0A2H4ZR10_9PHAE1.370e-7070.81Ribosomal protein S7 n=2 Tax=Endarachne binghamiae... [more]
A0A1I9LW96_9PHAE1.560e-7070.12Ribosomal protein S7 (Fragment) n=1 Tax=Pleuroclad... [more]
A0A8F0JZY2_AKKLU6.710e-7069.57Ribosomal protein S7 n=1 Tax=Akkesiphycus lubricus... [more]

Pages

back to top