prot_E_fasciculatus_S2_contig9815.17823.1 (polypeptide) Ectocarpus fasciculatus EfasUO2

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E_fasciculatus_S2_contig9815.17823.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus fasciculatus EfasUO2 vs UniRef90)
Total hits: 6
ZOOM
x 1
POSITION
0
RSVNTHLARRRLCYTNSLAPSPKARVKSAATWICFYQVTRRPRQHELHMSTRRSNRDKNTHQKNESQQAKCQRTRVAKAKKSVANATEALKPEGLDALHVEDVTVLQGCPAGHRDLSPSPD102030405060708090100110120Expect = 2.29e-10 / Id = 83.72Expect = 2.40e-10 / Id = 83.72Expect = 5.14e-10 / Id = 85.00Expect = 2.80e-9 / Id = 85.00Expect = 1.00e-6 / Id = 71.43Expect = 1.04e-6 / Id = 74.42SequenceD7G605_ECTSID7G077_ECTSIA0A6H5JN86_9PHAEA0A6H5KX16_9PHAEA0A6H5KBC1_9PHAEA0A6H5KGU5_9PHAE
Match NameE-valueIdentityDescription
D7G605_ECTSI2.290e-1083.72Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
D7G077_ECTSI2.400e-1083.72Uncharacterized protein n=2 Tax=Ectocarpus silicul... [more]
A0A6H5JN86_9PHAE5.140e-1085.00Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5KX16_9PHAE2.800e-985.00SET domain-containing protein n=1 Tax=Ectocarpus s... [more]
A0A6H5KBC1_9PHAE1.000e-671.43Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5KGU5_9PHAE1.040e-674.42Uncharacterized protein n=2 Tax=Ectocarpus sp. CCA... [more]
back to top