prot_D-dichotoma_M_contig943.20158.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A6H5KT20_9PHAE (FtsJ domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KT20_9PHAE) HSP 1 Score: 99.8 bits (247), Expect = 1.380e-22 Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 0 Query: 23 VDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGFL 84 ++G G GLLARGGTFLGKF AGRDERE+KEEA +LF++V+VVKPPASRS S EMYLLATGFL Sbjct: 473 IEGEGPGLLARGGTFLGKFFAGRDEREVKEEAERLFERVKVVKPPASRSGSGEMYLLATGFL 534
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A6L7XH06_9PROT (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Rhodospirillales bacterium TaxID=2026786 RepID=A0A6L7XH06_9PROT) HSP 1 Score: 64.7 bits (156), Expect = 1.300e-10 Identity = 43/84 (51.19%), Postives = 51/84 (60.71%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGR-LDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 83 MAP +G R DQ R L A VD + LLA GGT L K + G+ E +L G F +VR KPPASRS SSEM+LLA+GF Sbjct: 142 MAPPATGHRSTDQLRSLALAEAAVD-CAAALLAPGGTLLVKLIRGQGEEDLVRALGDTFAEVRREKPPASRSDSSEMFLLASGF 224
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A0D0PZK0_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Wenxinia marina DSM 24838 TaxID=1123501 RepID=A0A0D0PZK0_9RHOB) HSP 1 Score: 62.8 bits (151), Expect = 7.870e-10 Identity = 39/83 (46.99%), Postives = 49/83 (59.04%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 83 MA S SG + D R+ + +LA GGTF+ K LAG E EL++ Q F KV VKPPASR+ SSE ++LATGF Sbjct: 153 MAASSSGHKQTDHIRIIALCEAAAELAFDVLAPGGTFVAKVLAGGAEGELQKRLKQAFTKVENVKPPASRADSSEKFVLATGF 235
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A4Q3Y9A2_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Loktanella sp. IMCC34160 TaxID=2510646 RepID=A0A4Q3Y9A2_9RHOB) HSP 1 Score: 61.6 bits (148), Expect = 2.020e-9 Identity = 39/83 (46.99%), Postives = 50/83 (60.24%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 83 MA S SG + D R+ + +LA GGTF+ K LAG E EL++ Q F+KV VKPPASRS SSE +++ATGF Sbjct: 154 MAASSSGHKQTDHLRIIALCEAAAYLAFDVLAPGGTFVAKVLAGGAEGELQKLLKQRFEKVANVKPPASRSDSSEKFVVATGF 236
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: UPI0009313B52 (RlmE family RNA methyltransferase n=1 Tax=Hyphomicrobium sp. CS1GBMeth3 TaxID=1892845 RepID=UPI0009313B52) HSP 1 Score: 61.2 bits (147), Expect = 2.880e-9 Identity = 33/57 (57.89%), Postives = 40/57 (70.18%), Query Frame = 0 Query: 30 LLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGFLEK 86 +LA GG FL K G EREL + Q FQ VR +KPPASRS S+E+Y+LATGF E+ Sbjct: 188 VLAPGGAFLCKVFQGGTERELLDFLKQRFQTVRHIKPPASRSDSAELYVLATGFKEQ 244
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: UPI000F8D4DB7 (RlmE family RNA methyltransferase n=1 Tax=Pararhodobacter zhoushanensis TaxID=2479545 RepID=UPI000F8D4DB7) HSP 1 Score: 60.5 bits (145), Expect = 6.080e-9 Identity = 39/83 (46.99%), Postives = 48/83 (57.83%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 83 MA S SG + D R+ +LA GGTF+ K LAG E EL++ Q F KV VKPPASR+ SSE Y++ATGF Sbjct: 163 MAASASGHKQTDHNRIMALCEHAAYFAFDVLAPGGTFVAKVLAGGAEGELQQLLKQRFTKVVNVKPPASRADSSEKYVVATGF 245
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A6P6YHX0_DERPT (rRNA methyltransferase 2, mitochondrial-like n=1 Tax=Dermatophagoides pteronyssinus TaxID=6956 RepID=A0A6P6YHX0_DERPT) HSP 1 Score: 60.1 bits (144), Expect = 6.510e-9 Identity = 35/83 (42.17%), Postives = 47/83 (56.63%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 83 M+P+ SG D D R+ + S L G FL K G +L E+ ++FQKVR VKP ASR+ S+E+Y+LATGF Sbjct: 137 MSPNVSGQHDYDHERIMQLVYSTIRFSSICLKDQGNFLAKIFNGNQTEKLIEDLSKMFQKVRQVKPEASRADSTELYVLATGF 219
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A839SRP2_9HYPH (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Limibacillus halophilus TaxID=1579333 RepID=A0A839SRP2_9HYPH) HSP 1 Score: 60.1 bits (144), Expect = 7.520e-9 Identity = 38/86 (44.19%), Postives = 49/86 (56.98%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGFLEK 86 MA S +G + D R+ + +LA G FL K L G E+EL + + F KVR VKPPASRS S+E+Y+LATGF K Sbjct: 149 MAASSTGHANTDHLRIMTLAEVALDFAEDVLAPDGFFLCKVLQGGSEKELLDRLRKSFAKVRHVKPPASRSDSAELYVLATGFRGK 234
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A1H8PV46_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Salinihabitans flavidus TaxID=569882 RepID=A0A1H8PV46_9RHOB) HSP 1 Score: 59.7 bits (143), Expect = 9.900e-9 Identity = 37/83 (44.58%), Postives = 48/83 (57.83%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 83 MA S SG + D R+ +L GGTF+ K LAG E EL++ Q F+KV +KPPASRS SSE +++ATGF Sbjct: 149 MAASSSGHKQTDHLRIISLCDAAAEFAFDVLEVGGTFVAKVLAGGAEGELQKRLKQRFEKVANIKPPASRSDSSEKFVVATGF 231
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: UPI000C186E3D (RlmE family RNA methyltransferase n=1 Tax=Oceaniglobus indicus TaxID=2047749 RepID=UPI000C186E3D) HSP 1 Score: 59.7 bits (143), Expect = 1.010e-8 Identity = 38/83 (45.78%), Postives = 47/83 (56.63%), Query Frame = 0 Query: 1 MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 83 MA S SG + D R+ +L GGTF+ K LAG E EL++ Q F KV VKPPASRS SSE +++ATGF Sbjct: 154 MAASSSGHKQTDHLRIISLCEAAAHFAFDVLEPGGTFVAKVLAGGAEHELQQLLKQKFTKVANVKPPASRSDSSEKFVVATGF 236 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig943.20158.1 ID=prot_D-dichotoma_M_contig943.20158.1|Name=mRNA_D-dichotoma_M_contig943.20158.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=87bpback to top |