prot_D-dudresnayi_contig10144.192.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Match: A0A7S0RCM2_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Pyramimonas obovata TaxID=1411642 RepID=A0A7S0RCM2_9CHLO) HSP 1 Score: 50.4 bits (119), Expect = 6.060e-6 Identity = 29/60 (48.33%), Postives = 38/60 (63.33%), Query Frame = 0 Query: 2 DYLILPLLLNG---ASVNFT--DPEGRTPLIVATAVGNAHAVRILIQHGADITHKDCTGK 56 D + L LL G A+VNF DP G TPL+ A +G+A AV IL++HGAD+ H D G+ Sbjct: 8 DGVSLLYLLTGRTKANVNFVGNDPSGWTPLLFAIDMGDASAVEILLEHGADVHHVDSNGE 67
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Match: V3ZEB1_LOTGI (Uncharacterized protein (Fragment) n=1 Tax=Lottia gigantea TaxID=225164 RepID=V3ZEB1_LOTGI) HSP 1 Score: 51.2 bits (121), Expect = 2.350e-5 Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 0 Query: 4 LILPLLLNGASVNFTDPEGRTPLIVATAVGNAHAVRILIQHGADITHKDCTGKCAFQH 61 ++ L+ G++VN +D G TPL+ A + ++R+LIQHGAD+ HKD G H Sbjct: 296 IVAKLITAGSNVNASDVYGYTPLMQAAFCKDLDSIRLLIQHGADLKHKDMDGNTLINH 353
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Match: A0A6P7YUX5_9AMPH (uncharacterized protein LOC115477963 n=1 Tax=Microcaecilia unicolor TaxID=1415580 RepID=A0A6P7YUX5_9AMPH) HSP 1 Score: 49.7 bits (117), Expect = 8.020e-5 Identity = 27/60 (45.00%), Postives = 33/60 (55.00%), Query Frame = 0 Query: 3 YLILPLLLN-GASVNFTDPEGRTPLIVATAVGNAHAVRILIQHGADITHKDCTGKCAFQH 61 Y +L + LN GA V TD E RT L A N H +LI HGA++ HKD G AF + Sbjct: 291 YEVLAMFLNSGADVESTDREQRTALFYAIFATNFHGASLLINHGANVHHKDNRGLTAFDY 350 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10144.192.1 ID=prot_D-dudresnayi_contig10144.192.1|Name=mRNA_D-dudresnayi_contig10144.192.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=95bpback to top |