mRNA_D-dudresnayi_contig10144.192.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Match: A0A6P7YUX5_9AMPH (uncharacterized protein LOC115477963 n=1 Tax=Microcaecilia unicolor TaxID=1415580 RepID=A0A6P7YUX5_9AMPH) HSP 1 Score: 53.1 bits (126), Expect = 2.480e-5 Identity = 33/87 (37.93%), Postives = 41/87 (47.13%), Query Frame = 1 Query: 61 ELRPLQERGGDINLAVALHSVVANQMDYLILPLLLN-GASVNFTDPEGRTPLIVATAVGNAHAVRILIQHGADITHKDCTGKCAFQH 318 EL L + G + LH Y +L + LN GA V TD E RT L A N H +LI HGA++ HKD G AF + Sbjct: 269 ELNSLSKNGNSV-----LHLAAIRNGTYEVLAMFLNSGADVESTDREQRTALFYAIFATNFHGASLLINHGANVHHKDNRGLTAFDY 350
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Match: A0A7S0RCM2_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Pyramimonas obovata TaxID=1411642 RepID=A0A7S0RCM2_9CHLO) HSP 1 Score: 50.1 bits (118), Expect = 3.690e-5 Identity = 29/60 (48.33%), Postives = 38/60 (63.33%), Query Frame = 1 Query: 139 DYLILPLLLNG---ASVNFT--DPEGRTPLIVATAVGNAHAVRILIQHGADITHKDCTGK 303 D + L LL G A+VNF DP G TPL+ A +G+A AV IL++HGAD+ H D G+ Sbjct: 8 DGVSLLYLLTGRTKANVNFVGNDPSGWTPLLFAIDMGDASAVEILLEHGADVHHVDSNGE 67
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Match: V3ZEB1_LOTGI (Uncharacterized protein (Fragment) n=1 Tax=Lottia gigantea TaxID=225164 RepID=V3ZEB1_LOTGI) HSP 1 Score: 51.6 bits (122), Expect = 8.840e-5 Identity = 27/80 (33.75%), Postives = 41/80 (51.25%), Query Frame = 1 Query: 79 ERGGDINLAVALHSVVANQMDYLILPLLLNGASVNFTDPEGRTPLIVATAVGNAHAVRILIQHGADITHKDCTGKCAFQH 318 E G I A + + ++ L+ G++VN +D G TPL+ A + ++R+LIQHGAD+ HKD G H Sbjct: 274 ENGETILSAAIMMKATHSPTSDIVAKLITAGSNVNASDVYGYTPLMQAAFCKDLDSIRLLIQHGADLKHKDMDGNTLINH 353 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10144.192.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10144.192.1 >prot_D-dudresnayi_contig10144.192.1 ID=prot_D-dudresnayi_contig10144.192.1|Name=mRNA_D-dudresnayi_contig10144.192.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=95bp MDYLILPLLLNGASVNFTDPEGRTPLIVATAVGNAHAVRILIQHGADITHback to top mRNA from alignment at D-dudresnayi_contig10144:9140..9835- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10144.192.1 ID=mRNA_D-dudresnayi_contig10144.192.1|Name=mRNA_D-dudresnayi_contig10144.192.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=696bp|location=Sequence derived from alignment at D-dudresnayi_contig10144:9140..9835- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10144:9140..9835- >mRNA_D-dudresnayi_contig10144.192.1 ID=mRNA_D-dudresnayi_contig10144.192.1|Name=mRNA_D-dudresnayi_contig10144.192.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=570bp|location=Sequence derived from alignment at D-dudresnayi_contig10144:9140..9835- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |