prot_D-dudresnayi_contig10099.134.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5K6M8_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6M8_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 3.770e-9 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAKGR 34 GA+QLA N +S+SNSK IDVRHHFLWELV +GR Sbjct: 320 GAIQLAQNPISNSNSKDIDVRHHFLWELVERGR 352
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KN68_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN68_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 3.440e-8 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKHIDVRHHFLWEL + Sbjct: 575 GAIQLAQNPISNSNSKHIDVRHHFLWELAER 605
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5LJF0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LJF0_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 4.880e-8 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKHIDVRHHFL ELV + Sbjct: 18 GAIQLAQNPISNSNSKHIDVRHHFLTELVER 48
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5JLZ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLZ5_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 6.920e-8 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKHIDVRHHFL ELV + Sbjct: 18 GAIQLAQNPISNSNSKHIDVRHHFLRELVER 48
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5K0S2_9PHAE (Uncharacterized protein n=6 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0S2_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 7.410e-8 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKHIDVRHHFL ELV + Sbjct: 18 GAIQLAQNPISNSNSKHIDVRHHFLRELVER 48
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KFJ4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFJ4_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 1.220e-7 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKHIDVRHHFL ELV + Sbjct: 50 GAIQLAQNPISNSNSKHIDVRHHFLRELVER 80
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5JDT0_9PHAE (Uncharacterized protein (Fragment) n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDT0_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 1.470e-7 Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKHIDVRHHFL +LV + Sbjct: 18 GAIQLAQNPISNSNSKHIDVRHHFLRKLVER 48
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5JFI8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFI8_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 2.630e-7 Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKH+DVRHHFL ELV + Sbjct: 18 GAIQLAQNPISNSNSKHMDVRHHFLRELVER 48
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KJ50_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJ50_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 3.550e-7 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 2 GALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 GA+QLA N +S+SNSKHIDVRHHFL ELV + Sbjct: 84 GAIQLARNPISNSNSKHIDVRHHFLRELVER 114
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KC09_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KC09_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 3.690e-7 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 1 MGALQLASNLVSSSNSKHIDVRHHFLWELVAK 32 +GA+QLA N +S+SNSKHIDVRHHFL ELV + Sbjct: 198 LGAIQLAQNPISNSNSKHIDVRHHFLRELVER 229 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10099.134.1 ID=prot_D-dudresnayi_contig10099.134.1|Name=mRNA_D-dudresnayi_contig10099.134.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=35bpback to top |