mRNA_D-dudresnayi_contig10099.134.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KZC8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZC8_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.830e-13 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 92 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 140
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5JH88_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH88_9PHAE) HSP 1 Score: 72.0 bits (175), Expect = 6.570e-13 Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKGR*RSSMYHRSTSMLTFSRNH 209 + PE + C VFEDN GA+QLA N +S+SNSKHID+RHHF+ ELV + +++ +MLT SR H Sbjct: 244 MLPEAGMPCIPVFEDNQGAIQLAQNPISNSNSKHIDLRHHFIRELVGRKEISIFTWNQCINMLTSSRRH 312
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KPR3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KPR3_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 7.490e-13 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 157 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 205
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5JHE6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHE6_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 1.060e-12 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 249 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIHERVARG 297
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5L610_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L610_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 1.670e-12 Identity = 30/49 (61.22%), Postives = 40/49 (81.63%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP +VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 46 IFPGCDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 94
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5JWG1_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWG1_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.540e-12 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 491 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 539
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5K0K7_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0K7_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.580e-12 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 671 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 719
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KGK7_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KGK7_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.590e-12 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 715 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 763
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5JE07_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JE07_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.630e-12 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 1004 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 1052
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Match: A0A6H5KAC2_9PHAE (Integrase catalytic domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAC2_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.660e-12 Identity = 31/49 (63.27%), Postives = 41/49 (83.67%), Query Frame = 3 Query: 3 LFPEREVGCTRVFEDNMGALQLASNLVSSSNSKHIDVRHHFLWELVAKG 149 +FP R+VGCT V+EDN+GA+ LASN ++ NSKHID+RHHF+ E VA+G Sbjct: 1791 IFPGRDVGCTPVWEDNVGAIHLASNPATTPNSKHIDIRHHFIRERVARG 1839 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10099.134.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10099.134.1 >prot_D-dudresnayi_contig10099.134.1 ID=prot_D-dudresnayi_contig10099.134.1|Name=mRNA_D-dudresnayi_contig10099.134.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=35bp MGALQLASNLVSSSNSKHIDVRHHFLWELVAKGR*back to top mRNA from alignment at D-dudresnayi_contig10099:5964..6366+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10099.134.1 ID=mRNA_D-dudresnayi_contig10099.134.1|Name=mRNA_D-dudresnayi_contig10099.134.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=403bp|location=Sequence derived from alignment at D-dudresnayi_contig10099:5964..6366+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10099:5964..6366+ >mRNA_D-dudresnayi_contig10099.134.1 ID=mRNA_D-dudresnayi_contig10099.134.1|Name=mRNA_D-dudresnayi_contig10099.134.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=210bp|location=Sequence derived from alignment at D-dudresnayi_contig10099:5964..6366+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top |