prot_D-dudresnayi_contig9888.28702.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: D7FY84_ECTSI (SGF29 C-terminal domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FY84_ECTSI) HSP 1 Score: 102 bits (254), Expect = 7.050e-24 Identity = 48/58 (82.76%), Postives = 51/58 (87.93%), Query Frame = 0 Query: 12 DESRGPYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAAR 69 DESRGPYFPFNR E YPKR+KVDFRRLP TLLTYT HHDL+VRPD +HEELAIA AR Sbjct: 7 DESRGPYFPFNRRETYPKRLKVDFRRLPTSTLLTYTAHHDLHVRPDSTHEELAIATAR 64
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: A0A6H5L5U0_9PHAE (SAP30_Sin3_bdg domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5U0_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 3.240e-13 Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = 0 Query: 14 SRGPYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAAR 69 S GPYFPF+R E YP+ + V+F+RL RTL Y H +NVRPDCS ELA+AAAR Sbjct: 9 SPGPYFPFHRDETYPRTLCVNFKRLEYRTLQKYCKLHGINVRPDCSQAELAVAAAR 64
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: D7FGV9_ECTSI (SGF29 C-terminal domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FGV9_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 2.820e-12 Identity = 33/54 (61.11%), Postives = 40/54 (74.07%), Query Frame = 0 Query: 16 GPYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAAR 69 GPYFPF+R E YP+ + V+F+RL RTL Y H +NVRPDCS ELA+AAAR Sbjct: 11 GPYFPFHRDETYPRTLCVNFKRLEYRTLQKYCKLHGINVRPDCSQAELAVAAAR 64
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: A0A7S4DFH4_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DFH4_HETAK) HSP 1 Score: 66.6 bits (161), Expect = 3.960e-12 Identity = 33/52 (63.46%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 17 PYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAA 68 PYFPF+R E YPK KVDFR+L TL Y H +NVRPD + EELAIAAA Sbjct: 21 PYFPFHRDEVYPKGTKVDFRKLKASTLELYALKHKINVRPDATREELAIAAA 72 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9888.28702.1 ID=prot_D-dudresnayi_contig9888.28702.1|Name=mRNA_D-dudresnayi_contig9888.28702.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=70bpback to top |