mRNA_D-dudresnayi_contig9888.28702.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: D7FY84_ECTSI (SGF29 C-terminal domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FY84_ECTSI) HSP 1 Score: 102 bits (255), Expect = 8.400e-24 Identity = 48/58 (82.76%), Postives = 51/58 (87.93%), Query Frame = 2 Query: 71 DESRGPYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAAR 244 DESRGPYFPFNR E YPKR+KVDFRRLP TLLTYT HHDL+VRPD +HEELAIA AR Sbjct: 7 DESRGPYFPFNRRETYPKRLKVDFRRLPTSTLLTYTAHHDLHVRPDSTHEELAIATAR 64
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: A0A6H5L5U0_9PHAE (SAP30_Sin3_bdg domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5U0_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 3.690e-13 Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = 2 Query: 77 SRGPYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAAR 244 S GPYFPF+R E YP+ + V+F+RL RTL Y H +NVRPDCS ELA+AAAR Sbjct: 9 SPGPYFPFHRDETYPRTLCVNFKRLEYRTLQKYCKLHGINVRPDCSQAELAVAAAR 64
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: D7FGV9_ECTSI (SGF29 C-terminal domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FGV9_ECTSI) HSP 1 Score: 70.1 bits (170), Expect = 3.360e-12 Identity = 33/54 (61.11%), Postives = 40/54 (74.07%), Query Frame = 2 Query: 83 GPYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAAR 244 GPYFPF+R E YP+ + V+F+RL RTL Y H +NVRPDCS ELA+AAAR Sbjct: 11 GPYFPFHRDETYPRTLCVNFKRLEYRTLQKYCKLHGINVRPDCSQAELAVAAAR 64
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Match: A0A7S4DFH4_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DFH4_HETAK) HSP 1 Score: 67.0 bits (162), Expect = 4.460e-12 Identity = 33/52 (63.46%), Postives = 37/52 (71.15%), Query Frame = 2 Query: 86 PYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHDLNVRPDCSHEELAIAAA 241 PYFPF+R E YPK KVDFR+L TL Y H +NVRPD + EELAIAAA Sbjct: 21 PYFPFHRDEVYPKGTKVDFRKLKASTLELYALKHKINVRPDATREELAIAAA 72 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9888.28702.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig9888.28702.1 >prot_D-dudresnayi_contig9888.28702.1 ID=prot_D-dudresnayi_contig9888.28702.1|Name=mRNA_D-dudresnayi_contig9888.28702.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=70bp MEAMQQDNHMEDESRGPYFPFNRTEPYPKRVKVDFRRLPRRTLLTYTGHHback to top mRNA from alignment at D-dudresnayi_contig9888:2148..3251- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig9888.28702.1 ID=mRNA_D-dudresnayi_contig9888.28702.1|Name=mRNA_D-dudresnayi_contig9888.28702.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=1104bp|location=Sequence derived from alignment at D-dudresnayi_contig9888:2148..3251- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig9888:2148..3251- >mRNA_D-dudresnayi_contig9888.28702.1 ID=mRNA_D-dudresnayi_contig9888.28702.1|Name=mRNA_D-dudresnayi_contig9888.28702.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=420bp|location=Sequence derived from alignment at D-dudresnayi_contig9888:2148..3251- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |