prot_D-dudresnayi_contig9882.28692.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9882.28692.1 vs. uniprot
Match: D8LMZ6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMZ6_ECTSI) HSP 1 Score: 90.9 bits (224), Expect = 5.280e-19 Identity = 55/97 (56.70%), Postives = 64/97 (65.98%), Query Frame = 0 Query: 17 ARKDFNIYMSKLLEHSAALDTFRPEDTRKLERTTGGASAGSSPAWGPAVGVSEDAGSAEARLGSPRAGP-VEVPLT-FTPSYFRETR-AWPRAGAVT 110 ARKDF IYM KLLEHS ALDTFRP+ TG PAWGP++G+SE+ GS GSP AG V+V + F+PS FRE + AWPRAGAVT Sbjct: 3 ARKDFKIYMDKLLEHSTALDTFRPDKRHSDAGDTGSGV----PAWGPSLGMSEEGGSVGEARGSPPAGAAVDVTMPPFSPSRFREEKHAWPRAGAVT 95 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9882.28692.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9882.28692.1 ID=prot_D-dudresnayi_contig9882.28692.1|Name=mRNA_D-dudresnayi_contig9882.28692.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=111bpback to top |