prot_D-dudresnayi_contig9865.28677.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JQJ2_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQJ2_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 7.240e-15 Identity = 32/95 (33.68%), Postives = 57/95 (60.00%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L Y+IE +I++ I R ++E V Sbjct: 22 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHKYDIERESILADPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5K4K8_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4K8_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 2.210e-14 Identity = 32/95 (33.68%), Postives = 58/95 (61.05%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I+ I R ++E V Sbjct: 22 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILVDPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JQ49_9PHAE (Uncharacterized protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQ49_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 4.280e-14 Identity = 32/95 (33.68%), Postives = 59/95 (62.11%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 22 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JS28_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JS28_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 4.760e-14 Identity = 32/95 (33.68%), Postives = 59/95 (62.11%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 22 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5KIP6_9PHAE (CCHC-type domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIP6_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 5.260e-14 Identity = 32/95 (33.68%), Postives = 59/95 (62.11%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 154 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 248
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JNE4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNE4_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 5.280e-14 Identity = 32/95 (33.68%), Postives = 59/95 (62.11%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 209 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 303
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5L4A7_9PHAE (CCHC-type domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4A7_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 5.310e-14 Identity = 32/95 (33.68%), Postives = 59/95 (62.11%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 154 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 248
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5KYI1_9PHAE (CCHC-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYI1_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 5.360e-14 Identity = 32/95 (33.68%), Postives = 59/95 (62.11%), Query Frame = 0 Query: 9 EAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 103 EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 154 EAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 248
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5L089_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L089_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 9.350e-11 Identity = 28/93 (30.11%), Postives = 55/93 (59.14%), Query Frame = 0 Query: 1 MYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRS 93 +++ EAW AI W +P + E+ + + E V M P E+P+++ ARVD +V+ + + + + E ++++ I R L+ DY++E + +S S Sbjct: 464 LFACSCVPEAWTAIREWSLPTTDAEQRLLERQLETVEMSPGENPKLFFARVDGIVNTMRAVGIEKSERQIVQTIVRQLSSDYDVERKTTLSDS 556 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9865.28677.1 ID=prot_D-dudresnayi_contig9865.28677.1|Name=mRNA_D-dudresnayi_contig9865.28677.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=104bpback to top |