mRNA_D-dudresnayi_contig9865.28677.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JQJ2_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQJ2_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 2.750e-15 Identity = 33/104 (31.73%), Postives = 60/104 (57.69%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L Y+IE +I++ I R ++E V Sbjct: 13 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHKYDIERESILADPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5K4K8_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4K8_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 8.600e-15 Identity = 33/104 (31.73%), Postives = 61/104 (58.65%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I+ I R ++E V Sbjct: 13 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILVDPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JQ49_9PHAE (Uncharacterized protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQ49_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 1.770e-14 Identity = 33/104 (31.73%), Postives = 62/104 (59.62%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 13 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JS28_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JS28_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 1.990e-14 Identity = 33/104 (31.73%), Postives = 62/104 (59.62%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 13 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 116
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5KIP6_9PHAE (CCHC-type domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIP6_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 2.220e-14 Identity = 33/104 (31.73%), Postives = 62/104 (59.62%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 145 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 248
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5JNE4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNE4_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 2.230e-14 Identity = 33/104 (31.73%), Postives = 62/104 (59.62%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 200 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 303
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5L4A7_9PHAE (CCHC-type domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4A7_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 2.250e-14 Identity = 33/104 (31.73%), Postives = 62/104 (59.62%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 145 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 248
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5KYI1_9PHAE (CCHC-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYI1_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 2.270e-14 Identity = 33/104 (31.73%), Postives = 62/104 (59.62%), Query Frame = 1 Query: 4 RMYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRSNICRVELELV 315 R+ + EAW+ I W +P + E+ + + + E + MHP EDP+++ ARVD V++I+ + + + E ++ I R L +Y+IE ++I++ I R ++E V Sbjct: 145 RLGACDCVPEAWSVIHEWLLPTLDAEKTLLVRRLETIEMHPGEDPKLFFARVDGVINIMKAVGIEKSERAIVHIIVRQLAHEYDIERKSILADPTISRAKVENV 248
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Match: A0A6H5L089_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L089_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 5.390e-11 Identity = 28/93 (30.11%), Postives = 55/93 (59.14%), Query Frame = 1 Query: 7 MYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARVDEVVDILACLEVFRDEAEVIRAINRGLTKDYEIESRAIISRS 285 +++ EAW AI W +P + E+ + + E V M P E+P+++ ARVD +V+ + + + + E ++++ I R L+ DY++E + +S S Sbjct: 464 LFACSCVPEAWTAIREWSLPTTDAEQRLLERQLETVEMSPGENPKLFFARVDGIVNTMRAVGIEKSERQIVQTIVRQLSSDYDVERKTTLSDS 556 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9865.28677.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig9865.28677.1 >prot_D-dudresnayi_contig9865.28677.1 ID=prot_D-dudresnayi_contig9865.28677.1|Name=mRNA_D-dudresnayi_contig9865.28677.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=104bp MYSLGSPSEAWAAIEVWFVPKGNTERDIWLNKFENVRMHPNEDPQIYLARback to top mRNA from alignment at D-dudresnayi_contig9865:27..344- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig9865.28677.1 ID=mRNA_D-dudresnayi_contig9865.28677.1|Name=mRNA_D-dudresnayi_contig9865.28677.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=318bp|location=Sequence derived from alignment at D-dudresnayi_contig9865:27..344- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig9865:27..344- >mRNA_D-dudresnayi_contig9865.28677.1 ID=mRNA_D-dudresnayi_contig9865.28677.1|Name=mRNA_D-dudresnayi_contig9865.28677.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=624bp|location=Sequence derived from alignment at D-dudresnayi_contig9865:27..344- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |