prot_D-dudresnayi_contig9610.28392.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9610.28392.1 vs. uniprot
Match: A0A7S3LZF3_9STRA (Hypothetical protein n=2 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3LZF3_9STRA) HSP 1 Score: 103 bits (258), Expect = 2.510e-24 Identity = 47/78 (60.26%), Postives = 62/78 (79.49%), Query Frame = 0 Query: 1 MSCIVTKLHSVVKDFSPRGGSSIVEVEGKIIVFGGADREQTHFQDIMAYGGNSGSNFCVVKASGDVPMPRSGHAVAAY 78 M+ VTKLH+ +K+FS RGG+S+VEV K+++FGGADR+QTHFQD+ Y + S F V+A+GDVPMPRSGH+V AY Sbjct: 18 MTSCVTKLHTSIKEFSERGGASLVEVNAKLLIFGGADRQQTHFQDLAVYNSAADSLFVTVRATGDVPMPRSGHSVVAY 95 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9610.28392.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9610.28392.1 ID=prot_D-dudresnayi_contig9610.28392.1|Name=mRNA_D-dudresnayi_contig9610.28392.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=78bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|