prot_D-dudresnayi_contig9589.28378.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9589.28378.1 vs. uniprot
Match: A0A482RSS7_9ARCH (BSD domain-containing protein (Fragment) n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RSS7_9ARCH) HSP 1 Score: 58.2 bits (139), Expect = 4.330e-9 Identity = 29/49 (59.18%), Postives = 35/49 (71.43%), Query Frame = 0 Query: 2 IASVLDQESEVSRFYAELVPISISPEEFWGRLFFRMSLVYRHGTGLDEE 50 + +VLD ESEVSRFYAELVP+ +S E FW R FFR+ L+ R G EE Sbjct: 11 LQAVLDAESEVSRFYAELVPLQLSAEVFWARYFFRLKLLTRLGRVNFEE 59 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9589.28378.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9589.28378.1 ID=prot_D-dudresnayi_contig9589.28378.1|Name=mRNA_D-dudresnayi_contig9589.28378.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=114bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|