prot_D-dudresnayi_contig9565.28353.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9565.28353.1 vs. uniprot
Match: A0A6H5JPS1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPS1_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 7.290e-8 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0 Query: 53 GHKFCNSVGCPNNYTPVPEAWKVRCEDGRCTEEQCCLA 90 G +CNS+GCP YTP+P AW+V C+D C QCC A Sbjct: 4 GKTYCNSIGCPGGYTPIPNAWEVECDDDPCEVSQCCEA 41
BLAST of mRNA_D-dudresnayi_contig9565.28353.1 vs. uniprot
Match: D7G5E9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5E9_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 9.260e-6 Identity = 21/38 (55.26%), Postives = 25/38 (65.79%), Query Frame = 0 Query: 53 GHKFCNSVGCPNNYTPVPEAWKVRCEDGRCTEEQCCLA 90 G +CNS+GCP YTP+P AW+V C D C QCC A Sbjct: 125 GGLYCNSIGCPGGYTPIPNAWEVECYDDSCEVSQCCEA 162
BLAST of mRNA_D-dudresnayi_contig9565.28353.1 vs. uniprot
Match: A0A6H5KRN6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRN6_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 6.610e-5 Identity = 19/35 (54.29%), Postives = 23/35 (65.71%), Query Frame = 0 Query: 56 FCNSVGCPNNYTPVPEAWKVRCEDGRCTEEQCCLA 90 +CNS+GCP YTP+P AW+V C C QCC A Sbjct: 114 YCNSIGCPGGYTPIPNAWEVECSGDSCEVSQCCEA 148 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9565.28353.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9565.28353.1 ID=prot_D-dudresnayi_contig9565.28353.1|Name=mRNA_D-dudresnayi_contig9565.28353.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=476bpback to top |