mRNA_D-dudresnayi_contig9565.28353.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9565.28353.1 vs. uniprot
Match: A0A6H5JPS1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPS1_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 1.090e-7 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 3 Query: 273 GHKFCNSVGCPNNYTPVPEAWKVRCEDGRCTEEQCCLA 386 G +CNS+GCP YTP+P AW+V C+D C QCC A Sbjct: 4 GKTYCNSIGCPGGYTPIPNAWEVECDDDPCEVSQCCEA 41
BLAST of mRNA_D-dudresnayi_contig9565.28353.1 vs. uniprot
Match: D7G5E9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5E9_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 1.570e-5 Identity = 21/38 (55.26%), Postives = 25/38 (65.79%), Query Frame = 3 Query: 273 GHKFCNSVGCPNNYTPVPEAWKVRCEDGRCTEEQCCLA 386 G +CNS+GCP YTP+P AW+V C D C QCC A Sbjct: 125 GGLYCNSIGCPGGYTPIPNAWEVECYDDSCEVSQCCEA 162 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9565.28353.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig9565.28353.1 >prot_D-dudresnayi_contig9565.28353.1 ID=prot_D-dudresnayi_contig9565.28353.1|Name=mRNA_D-dudresnayi_contig9565.28353.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=476bp MTRAYAAVAAFLSVVAMRAATGTSFQDASGGMFKKKHANVGLRGGRRATEback to top mRNA from alignment at D-dudresnayi_contig9565:3127..7865- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig9565.28353.1 ID=mRNA_D-dudresnayi_contig9565.28353.1|Name=mRNA_D-dudresnayi_contig9565.28353.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=4739bp|location=Sequence derived from alignment at D-dudresnayi_contig9565:3127..7865- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig9565:3127..7865- >mRNA_D-dudresnayi_contig9565.28353.1 ID=mRNA_D-dudresnayi_contig9565.28353.1|Name=mRNA_D-dudresnayi_contig9565.28353.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=2856bp|location=Sequence derived from alignment at D-dudresnayi_contig9565:3127..7865- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |