prot_D-dudresnayi_contig9562.28350.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9562.28350.1 vs. uniprot
Match: A0A6H5JNL0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNL0_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 5.720e-8 Identity = 37/88 (42.05%), Postives = 51/88 (57.95%), Query Frame = 0 Query: 1 MLWKAWPVAVASQLSYSASSRST-----------------TPGERPKAAGEGLL-----LRAVLALAGSLAKGFPDGKKAFIFAGPEG 66 +LWKAWP+A+ASQL++S+ S S+ T G P + +L L+A+L LA +A+ P+GKKAFIFAGPEG Sbjct: 1861 LLWKAWPMALASQLAHSSRSSSSHRRHDYHNHRRSSTSVDTCGTMPSSERRNMLETPVLLQALLGLASCVARSCPEGKKAFIFAGPEG 1948
BLAST of mRNA_D-dudresnayi_contig9562.28350.1 vs. uniprot
Match: D7G379_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G379_ECTSI) HSP 1 Score: 54.7 bits (130), Expect = 7.010e-7 Identity = 37/91 (40.66%), Postives = 49/91 (53.85%), Query Frame = 0 Query: 1 MLWKAWPVAVASQLSYSASSRS-------------------------TTPGERPKAAGEGLLLRAVLALAGSLAKGFPDGKKAFIFAGPEG 66 +LWKAWP+A+ASQL++S+ S S T G R +LL+A+L LA +A+ P+GKKAFIFAGPEG Sbjct: 2817 LLWKAWPMALASQLAHSSRSSSHRXXXXXXXRRGSTSVGSCGMATAGTASGRRDMLETP-VLLQALLGLASCVARSCPEGKKAFIFAGPEG 2906 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9562.28350.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9562.28350.1 ID=prot_D-dudresnayi_contig9562.28350.1|Name=mRNA_D-dudresnayi_contig9562.28350.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=75bpback to top |