prot_D-dudresnayi_contig9425.28229.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9425.28229.1 vs. uniprot
Match: D7FZS9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FZS9_ECTSI) HSP 1 Score: 89.0 bits (219), Expect = 5.100e-22 Identity = 40/63 (63.49%), Postives = 53/63 (84.13%), Query Frame = 0 Query: 1 MLRRGVMKFIDREPVAAISVLIGTVGFSLPLVVPPIREAMGYTTKQSNPTAELPKPRLTAGAS 63 MLRRG++KF+DREPVAA+S+ +G GFSLP +VPPIR+++G TKQS+PT ELPKPR+ G + Sbjct: 1 MLRRGLLKFVDREPVAAVSLGLGFFGFSLPFIVPPIRQSLGLCTKQSSPTCELPKPRMAPGVA 63
BLAST of mRNA_D-dudresnayi_contig9425.28229.1 vs. uniprot
Match: E1ZEZ1_CHLVA (Uncharacterized protein n=1 Tax=Chlorella variabilis TaxID=554065 RepID=E1ZEZ1_CHLVA) HSP 1 Score: 46.6 bits (109), Expect = 2.530e-5 Identity = 25/47 (53.19%), Postives = 31/47 (65.96%), Query Frame = 0 Query: 10 IDREPVAAISVLIGTVGFSLPLVVPPIREAMGYTTKQSNPTAELPKP 56 + +EP+ S +IG VG +LPLVVPPIREAMGY PT + P P Sbjct: 8 MHQEPIIVWSFIIGGVGLALPLVVPPIREAMGYGA----PTPKSPPP 50
BLAST of mRNA_D-dudresnayi_contig9425.28229.1 vs. uniprot
Match: A0A2P6THQ5_CHLSO (Uncharacterized protein n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6THQ5_CHLSO) HSP 1 Score: 45.4 bits (106), Expect = 7.230e-5 Identity = 21/35 (60.00%), Postives = 26/35 (74.29%), Query Frame = 0 Query: 10 IDREPVAAISVLIGTVGFSLPLVVPPIREAMGYTT 44 + REPV S +IG +G +LPLVVPPIRE +GY T Sbjct: 8 MHREPVICWSFIIGGIGLALPLVVPPIREQLGYNT 42 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9425.28229.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9425.28229.1 ID=prot_D-dudresnayi_contig9425.28229.1|Name=mRNA_D-dudresnayi_contig9425.28229.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=65bpback to top |