prot_D-dudresnayi_contig10135.172.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A4Y2R182_ARAVE (Uncharacterized protein n=1 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2R182_ARAVE) HSP 1 Score: 62.8 bits (151), Expect = 2.260e-9 Identity = 39/91 (42.86%), Postives = 54/91 (59.34%), Query Frame = 0 Query: 8 ERWLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTAR-LDKVVYVPDLAINLVSLEASHKKGVGF 95 E+W+ADSGAS HMTS +D + PS+ V +GN++ I++ YG TVNF G W L +V YVPD++ NL S+ + KG F Sbjct: 65 EQWIADSGASAHMTSYRKYFLDFKDFPSSKPVYVGNNNAIMV--YGQGTVNFDMNVNGKWVNNHLSEVWYVPDVSRNLFSVSQTLAKGFVF 153
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A0V1HEX2_9BILA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Trichinella zimbabwensis TaxID=268475 RepID=A0A0V1HEX2_9BILA) HSP 1 Score: 61.2 bits (147), Expect = 8.960e-9 Identity = 42/91 (46.15%), Postives = 53/91 (58.24%), Query Frame = 0 Query: 10 WLADSGASYHMTSS----ADSVVDVQPSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTA-RLDKVVYVPDLAINLVSLEASHKKGVGF 95 WLADSGAS HMT + AD V QP N V+IGN I + +G TVNF +G W R++ V YVP L +NL S+E + +KG F Sbjct: 151 WLADSGASQHMTRNKEYLADFVTFPQPVN--VKIGNGDAIPVYGWG--TVNFKVFIKGKWILNRMEVVWYVPKLGLNLFSIEKAAEKGFNF 237
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A4Y2SNE9_ARAVE (CCHC-type domain-containing protein n=1 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2SNE9_ARAVE) HSP 1 Score: 59.7 bits (143), Expect = 2.120e-8 Identity = 38/91 (41.76%), Postives = 55/91 (60.44%), Query Frame = 0 Query: 8 ERWLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTAR-LDKVVYVPDLAINLVSLEASHKKGVGF 95 E+W+ADSGAS HMTS +D + PS V +GN++ I+ +YG TVN + G W + L +V YVPD++ NL+S+ + KG F Sbjct: 101 EQWIADSGASAHMTSYRKYFLDFKEFPSPKPVNVGNNNAIM--AYGQGTVNVDMKVNGKWVSNHLSEVWYVPDVSRNLLSVCQTLAKGFVF 189
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A4Y2N6L3_ARAVE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=3 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2N6L3_ARAVE) HSP 1 Score: 59.7 bits (143), Expect = 3.360e-8 Identity = 38/91 (41.76%), Postives = 54/91 (59.34%), Query Frame = 0 Query: 8 ERWLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTAR-LDKVVYVPDLAINLVSLEASHKKGVGF 95 E+W+ADSGAS HMTS +D + PS V +GN++ I+ +YG TVN + G W + L +V YVPD++ NL S+ + KG F Sbjct: 266 EQWIADSGASAHMTSYRKYFLDFKEFPSPKPVYVGNNNAIM--AYGQGTVNVDMKVNGKWVSNHLSEVWYVPDVSRNLFSVSQTLAKGFVF 354
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A0V1M1K0_9BILA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=13 Tax=Trichinella TaxID=6333 RepID=A0A0V1M1K0_9BILA) HSP 1 Score: 59.7 bits (143), Expect = 3.360e-8 Identity = 41/91 (45.05%), Postives = 51/91 (56.04%), Query Frame = 0 Query: 10 WLADSGASYHMTSS----ADSVVDVQPSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTA-RLDKVVYVPDLAINLVSLEASHKKGVGF 95 WLADSGAS HMT + AD V QP N K+R G+ I +YG TVNF +G W R++ V YVP L +NL S+ + KG F Sbjct: 282 WLADSGASQHMTHNKEYLADFVTFPQPVNVKIRNGD----AIPAYGRGTVNFKVFIKGKWILNRMEDVWYVPKLGLNLFSIGKAADKGFYF 368
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A4Y2MJB6_ARAVE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2MJB6_ARAVE) HSP 1 Score: 59.3 bits (142), Expect = 4.090e-8 Identity = 38/91 (41.76%), Postives = 53/91 (58.24%), Query Frame = 0 Query: 8 ERWLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTAR-LDKVVYVPDLAINLVSLEASHKKGVGF 95 E+W+ADSGAS HMTS +D + PS V +GN + I+ +YG TVN + G W + L +V YVPD++ NL S+ + KG F Sbjct: 151 EQWIADSGASAHMTSYRKYFLDFKEFPSPKPVYVGNSNAIM--AYGQGTVNVDMKVNGKWVSNHLSEVWYVPDVSRNLFSVSQTLAKGFVF 239
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A4Y2KU41_ARAVE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2KU41_ARAVE) HSP 1 Score: 58.2 bits (139), Expect = 1.150e-7 Identity = 38/91 (41.76%), Postives = 54/91 (59.34%), Query Frame = 0 Query: 8 ERWLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTAR-LDKVVYVPDLAINLVSLEASHKKGVGF 95 E+W+ADSGAS HMTS +D + PS V +GN++ I+ +YG TVN + G W + L +V YVPD++ NL S+ + KG F Sbjct: 266 EQWIADSGASAHMTSYRKYFLDFKEFPSPKPVYVGNNNAIM--AYGQGTVNVDMKVNGKWVSNHLSEVWYVPDVSRNLFSVCQTLAKGFVF 354
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A0V0WE00_9BILA (Copia protein n=4 Tax=Trichinella sp. T6 TaxID=92179 RepID=A0A0V0WE00_9BILA) HSP 1 Score: 57.8 bits (138), Expect = 1.490e-7 Identity = 37/89 (41.57%), Postives = 51/89 (57.30%), Query Frame = 0 Query: 10 WLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTA-RLDKVVYVPDLAINLVSLEASHKKGVGF 95 WLADSGAS HMT + + + D P V++GN I +YG+ TVNF +G W R++ V YVP L +NL S+ + +KG F Sbjct: 282 WLADSGASQHMTRNKEYLSDFVTFPKPVNVKVGNGDAI--PAYGHGTVNFKVFIKGKWILNRMEDVWYVPKLGLNLFSIGKATEKGFNF 368
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A1Y3EJI6_9BILA (Integrase core domain protein n=1 Tax=Trichinella nativa TaxID=6335 RepID=A0A1Y3EJI6_9BILA) HSP 1 Score: 57.8 bits (138), Expect = 1.560e-7 Identity = 37/89 (41.57%), Postives = 51/89 (57.30%), Query Frame = 0 Query: 10 WLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTA-RLDKVVYVPDLAINLVSLEASHKKGVGF 95 WLADSGAS HMT + + + D P V++GN I +YG+ TVNF +G W R++ V YVP L +NL S+ + +KG F Sbjct: 34 WLADSGASQHMTRNKEYLSDFVTFPKPVNVKVGNGDAI--PAYGHGTVNFKVFIKGKWILNRMEDVWYVPKLGLNLFSIGKATEKGFNF 120
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Match: A0A0V0WA51_9BILA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Trichinella sp. T6 TaxID=92179 RepID=A0A0V0WA51_9BILA) HSP 1 Score: 57.8 bits (138), Expect = 1.570e-7 Identity = 37/89 (41.57%), Postives = 51/89 (57.30%), Query Frame = 0 Query: 10 WLADSGASYHMTSSADSVVDVQ--PSNDKVRIGNDSLIVIESYGNLTVNFPRQEEGGWTA-RLDKVVYVPDLAINLVSLEASHKKGVGF 95 WLADSGAS HMT + + + D P V++GN I +YG+ TVNF +G W R++ V YVP L +NL S+ + +KG F Sbjct: 2 WLADSGASQHMTRNKEYLSDFVTFPKPVNVKVGNGDAI--PAYGHGTVNFKVFIKGKWILNRMEDVWYVPKLGLNLFSIGKATEKGFNF 88 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10135.172.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10135.172.1 ID=prot_D-dudresnayi_contig10135.172.1|Name=mRNA_D-dudresnayi_contig10135.172.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=102bpback to top |