prot_D-dudresnayi_contig10093.130.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: A0A6H5KRR2_9PHAE (NAD(P)-bd_dom domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRR2_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 9.410e-17 Identity = 38/40 (95.00%), Postives = 39/40 (97.50%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVESIYR 40 GLTLD PRGVTAIELNQGDTKSGRIAR+DVARVCVESIYR Sbjct: 64 GLTLDPPRGVTAIELNQGDTKSGRIARADVARVCVESIYR 103
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: D8LDG8_ECTSI (NAD(P)-bd_dom domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDG8_ECTSI) HSP 1 Score: 73.2 bits (178), Expect = 4.080e-14 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVESIY 39 GLTLD PRGV AIELNQGDTKSGRIAR+DVARVCVESIY Sbjct: 273 GLTLDPPRGVGAIELNQGDTKSGRIARADVARVCVESIY 311
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: A0A7S1CTA4_9STRA (Hypothetical protein n=1 Tax=Skeletonema marinoi TaxID=267567 RepID=A0A7S1CTA4_9STRA) HSP 1 Score: 66.6 bits (161), Expect = 8.920e-12 Identity = 31/38 (81.58%), Postives = 36/38 (94.74%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVESI 38 GLTLD PRGV AIELNQGDTKSGR+AR+DVA++CVES+ Sbjct: 262 GLTLDPPRGVAAIELNQGDTKSGRLARADVAQLCVESL 299
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: A0A7S1ZWK7_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S1ZWK7_TRICV) HSP 1 Score: 62.0 bits (149), Expect = 6.650e-11 Identity = 29/38 (76.32%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVESI 38 GLT D PRG A+ELNQGDTKSGRI+R+DVA +CVESI Sbjct: 57 GLTTDPPRGAAALELNQGDTKSGRISRADVAALCVESI 94
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: B7G342_PHATC (Predicted protein n=2 Tax=Phaeodactylum tricornutum TaxID=2850 RepID=B7G342_PHATC) HSP 1 Score: 63.5 bits (153), Expect = 1.140e-10 Identity = 29/37 (78.38%), Postives = 34/37 (91.89%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVES 37 GLT D PRGVTA+ELNQGDTKSGRIAR+DVA +C+E+ Sbjct: 268 GLTEDAPRGVTALELNQGDTKSGRIARADVAALCIEA 304
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: A0A7S2HEC2_9STRA (Hypothetical protein n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2HEC2_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 4.110e-10 Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVESI 38 GLT D PRGV A+ELNQGDTKSGRI+R+DVA +CVE + Sbjct: 295 GLTTDPPRGVAAVELNQGDTKSGRISRADVAAICVECL 332
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: A0A1Y5ICD0_OSTTA (NAD(P)-bd_dom domain-containing protein n=1 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A1Y5ICD0_OSTTA) HSP 1 Score: 58.2 bits (139), Expect = 1.590e-9 Identity = 27/40 (67.50%), Postives = 33/40 (82.50%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVESIYR 40 GL+ DL RGV+A+ELNQGD SGRI+R DVA +C+ESI R Sbjct: 30 GLSEDLARGVSALELNQGDEMSGRISREDVAAICIESISR 69
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: C1FI73_MICCC (NAD(P)-bd_dom domain-containing protein n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1FI73_MICCC) HSP 1 Score: 59.7 bits (143), Expect = 2.530e-9 Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVES 37 GLT D PRGV AIELNQGD KSGRI+RSDVA +CVE+ Sbjct: 219 GLTEDEPRGVGAIELNQGDDKSGRISRSDVAAICVEA 255
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: A0A7S4KXC8_GUITH (Hypothetical protein n=1 Tax=Guillardia theta TaxID=55529 RepID=A0A7S4KXC8_GUITH) HSP 1 Score: 55.8 bits (133), Expect = 5.250e-9 Identity = 24/31 (77.42%), Postives = 30/31 (96.77%), Query Frame = 0 Query: 9 GVTAIELNQGDTKSGRIARSDVARVCVESIY 39 GV+++ELNQGDTKSGRIAR+DVA +CVESI+ Sbjct: 6 GVSSVELNQGDTKSGRIARADVAEICVESIF 36
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Match: L1IPP0_GUITC (NAD(P)-bd_dom domain-containing protein n=2 Tax=Guillardia theta TaxID=55529 RepID=L1IPP0_GUITC) HSP 1 Score: 58.5 bits (140), Expect = 6.120e-9 Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 0 Query: 1 GLTLDLPRGVTAIELNQGDTKSGRIARSDVARVCVESIY 39 GLT GV+++ELNQGDTKSGRIAR+DVA +CVESI+ Sbjct: 201 GLTEGAALGVSSVELNQGDTKSGRIARADVAEICVESIF 239 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10093.130.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 21
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10093.130.1 ID=prot_D-dudresnayi_contig10093.130.1|Name=mRNA_D-dudresnayi_contig10093.130.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=41bpback to top |