prot_D-dudresnayi_contig10064.102.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10064.102.1 vs. uniprot
Match: A0A4R0MPM8_9SPHI (Carbohydrate-binding protein n=1 Tax=Pedobacter frigiditerrae TaxID=2530452 RepID=A0A4R0MPM8_9SPHI) HSP 1 Score: 53.1 bits (126), Expect = 3.280e-6 Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 0 Query: 1 WDDSVENLAGGGSRNAS-VDVEAGADGTFHVGFGVPGEWLKYTVYVPEGGVFNITARYATLADSTALAITVD 71 + DS +G R + VDV+ DG ++VG+ V GEWL YT++VPE + IT RYA ++ + + D Sbjct: 485 YHDSTTGNSGSSYRTSEDVDVQTCTDGGYNVGWTVTGEWLTYTIHVPETKNYEITIRYAASVSTSKIRLEFD 556
BLAST of mRNA_D-dudresnayi_contig10064.102.1 vs. uniprot
Match: A0A2N1VUP5_9BACT (Glycoside hydrolase family 5 n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-2 TaxID=2013809 RepID=A0A2N1VUP5_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 1.130e-5 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 10 GGGSRNASVDVEAGAD---GTFHVGFGVPGEWLKYTVYVPEGGVFNITARYA 58 GG RN VD+E D F+VG+ GEWLKYTV VPE G FN++ RYA Sbjct: 434 GGIYRNDGVDIEPCTDQLTNGFNVGWIESGEWLKYTVDVPETGYFNLSIRYA 485
BLAST of mRNA_D-dudresnayi_contig10064.102.1 vs. uniprot
Match: UPI001EE94367 (cellulase family glycosylhydrolase n=1 Tax=Lewinella maritima TaxID=1383882 RepID=UPI001EE94367) HSP 1 Score: 50.8 bits (120), Expect = 2.150e-5 Identity = 25/74 (33.78%), Postives = 39/74 (52.70%), Query Frame = 0 Query: 2 DDSVENLAGGGSRNASVDVEAGADGTFHVGFGVPGEWLKYTVYVPEGGVFNITARYATLADSTALAITVDDGTN 75 D EN+ + VD+ G F VG+ GEWL+YTV VPE G F ++A A+ + +L ++ G++ Sbjct: 450 DSEAENIPNEYRTDEGVDIGGNGSGGFAVGYVARGEWLEYTVLVPEAGAFAVSAALASEQGNGSLKVSASGGSS 523
BLAST of mRNA_D-dudresnayi_contig10064.102.1 vs. uniprot
Match: B8GHS0_METPE (Probable pectate lyase C n=2 Tax=Methanosphaerula palustris TaxID=475088 RepID=B8GHS0_METPE) HSP 1 Score: 49.7 bits (117), Expect = 5.490e-5 Identity = 31/80 (38.75%), Postives = 41/80 (51.25%), Query Frame = 0 Query: 1 WDDSVENLAGGGSRNASVDVEAGADGTFHVGFGVPGEWLKYTVYVPEGGVFNITARYATLADSTALAITVDDGTNLACDR 80 + D+ GG R VD+E G +VG GEWL YT+ VPEGG + +TAR AT + I+V+ T A R Sbjct: 600 YHDTTPGNTGGAYRQDDVDIET-TGGITYVGGIQDGEWLIYTLNVPEGGAYLMTARVATPNEGLMARISVNSETMFALIR 678
BLAST of mRNA_D-dudresnayi_contig10064.102.1 vs. uniprot
Match: A0A1Z7ZCP6_9GAMM (Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium 42_54_T18 TaxID=1856293 RepID=A0A1Z7ZCP6_9GAMM) HSP 1 Score: 49.3 bits (116), Expect = 7.510e-5 Identity = 25/66 (37.88%), Postives = 39/66 (59.09%), Query Frame = 0 Query: 3 DSVENLAGGGSRNASVDVEAGAD--GTFHVGFGVPGEWLKYTVYVPEGGVFNITARYATLADSTAL 66 D+ GG R VD+EA D G + VG+ PGE+L+YT+ VPE G + + +R +T+ +S + Sbjct: 127 DTTPGNTGGTYRQEDVDIEATTDIGGGYSVGWVSPGEYLRYTISVPESGEYLLRSRVSTIKNSRSF 192 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10064.102.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10064.102.1 ID=prot_D-dudresnayi_contig10064.102.1|Name=mRNA_D-dudresnayi_contig10064.102.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=83bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|