mRNA_D-dudresnayi_contig10425.461.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10425.461.1 vs. uniprot
Match: D8LSJ6_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LSJ6_ECTSI) HSP 1 Score: 87.8 bits (216), Expect = 4.350e-18 Identity = 45/67 (67.16%), Postives = 55/67 (82.09%), Query Frame = 2 Query: 2 VAPGARSTRAALAACWGAEDIETALEVYGVMCKAEIRPDNRSLLELVKLCKANDMPDTAARIMRERS 202 VAPG RSTRAALAAC GA D++TAL+VY VM + IRP++R+LL+LV LC+AN + AARIMRERS Sbjct: 1007 VAPGPRSTRAALAACGGAGDVDTALQVYDVMREGGIRPNSRALLDLVNLCRANGLQSVAARIMRERS 1073
BLAST of mRNA_D-dudresnayi_contig10425.461.1 vs. uniprot
Match: A0A836CEM1_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CEM1_9STRA) HSP 1 Score: 65.1 bits (157), Expect = 4.060e-10 Identity = 35/71 (49.30%), Postives = 47/71 (66.20%), Query Frame = 2 Query: 2 VAPGARSTRAALAACWGAEDIETALEVYGVMCKAEIRPDNRSLLELVKLCKANDMPDTAARIMRERSNVTY 214 +AP +R+ L AC D+ AL VYGVM A IRPDNRSLL LV+LC++ M D A I+R+RS++ + Sbjct: 788 LAPSSRTCSLVLGACRHQGDLTQALSVYGVMNTAGIRPDNRSLLSLVRLCESAGMADKARDIIRDRSSLEH 858 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10425.461.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10425.461.1 >prot_D-dudresnayi_contig10425.461.1 ID=prot_D-dudresnayi_contig10425.461.1|Name=mRNA_D-dudresnayi_contig10425.461.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=91bp RSSWGEVDEGGAGRLLGSRRHRNRARGVRRDVQSGNTTRQSLAPGAGQALback to top mRNA from alignment at D-dudresnayi_contig10425:4140..4960- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10425.461.1 ID=mRNA_D-dudresnayi_contig10425.461.1|Name=mRNA_D-dudresnayi_contig10425.461.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=821bp|location=Sequence derived from alignment at D-dudresnayi_contig10425:4140..4960- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10425:4140..4960- >mRNA_D-dudresnayi_contig10425.461.1 ID=mRNA_D-dudresnayi_contig10425.461.1|Name=mRNA_D-dudresnayi_contig10425.461.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=546bp|location=Sequence derived from alignment at D-dudresnayi_contig10425:4140..4960- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |