mRNA_D-dudresnayi_contig10147.199.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: D1GJQ3_FUCVE (Photosystem I reaction center subunit IV n=2 Tax=Fucus TaxID=3011 RepID=D1GJQ3_FUCVE) HSP 1 Score: 111 bits (277), Expect = 5.700e-31 Identity = 50/59 (84.75%), Postives = 57/59 (96.61%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEELI 177 M+ KGAKVRILRKESYWYND+GTV V+EQ+TSNYPVLVRF+KVNYSGTNTANFK+EEL+ Sbjct: 1 MIEKGAKVRILRKESYWYNDVGTVAVIEQATSNYPVLVRFIKVNYSGTNTANFKLEELV 59
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: A0A8F0FAS1_9PHAE (Photosystem I reaction center subunit IV n=1 Tax=Desmarestia aculeata TaxID=62298 RepID=A0A8F0FAS1_9PHAE) HSP 1 Score: 110 bits (274), Expect = 1.590e-30 Identity = 54/61 (88.52%), Postives = 57/61 (93.44%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEELIDI 183 MV K AKVRILRKESYWYNDIGTVVVVEQ+ SNYPVLVRFVKVNYSGTNTANFK+EEL+ I Sbjct: 1 MVTKAAKVRILRKESYWYNDIGTVVVVEQTGSNYPVLVRFVKVNYSGTNTANFKVEELLVI 61
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: A0A1I9LW11_9PHAE (Photosystem I reaction center subunit IV n=1 Tax=Pleurocladia lacustris TaxID=246121 RepID=A0A1I9LW11_9PHAE) HSP 1 Score: 106 bits (265), Expect = 3.770e-29 Identity = 51/58 (87.93%), Postives = 54/58 (93.10%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEEL 174 MV KG KVRILRKESYWYNDIGTVVVVE+S SNYP+LVRFVKVNYSGTNTANFK EE+ Sbjct: 1 MVEKGTKVRILRKESYWYNDIGTVVVVEKSASNYPILVRFVKVNYSGTNTANFKAEEV 58
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: D1J723_ECTSI (Photosystem I reaction center subunit IV n=2 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D1J723_ECTSI) HSP 1 Score: 106 bits (264), Expect = 5.360e-29 Identity = 48/58 (82.76%), Postives = 55/58 (94.83%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEEL 174 MV KGAKVRILRKESYWYND+GTVVV+++ +NYPVL+RFVKVNYSGTNTANFK+EEL Sbjct: 1 MVTKGAKVRILRKESYWYNDVGTVVVIDKKAANYPVLIRFVKVNYSGTNTANFKLEEL 58
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: A0A0S0G9P7_COSCS (Photosystem I reaction center subunit IV n=22 Tax=Laminariales TaxID=2886 RepID=A0A0S0G9P7_COSCS) HSP 1 Score: 105 bits (263), Expect = 7.620e-29 Identity = 50/59 (84.75%), Postives = 55/59 (93.22%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEELI 177 MV KGAKVRILRKESYWYND+GTVV+VE+ SNYPVLVRFVKVNYSGTNT+NFK EEL+ Sbjct: 1 MVEKGAKVRILRKESYWYNDVGTVVIVEKVASNYPVLVRFVKVNYSGTNTSNFKQEELV 59
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: UPI001FA77104 (photosystem I subunit IV n=1 Tax=Silvetia siliquosa TaxID=93837 RepID=UPI001FA77104) HSP 1 Score: 105 bits (262), Expect = 1.110e-28 Identity = 46/61 (75.41%), Postives = 56/61 (91.80%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEELIDI 183 M+ KGAKVRILRKESYWYN++GTV ++E TS+YPVLVRF+KVNYSGTNTANFK+EEL+ + Sbjct: 1 MIKKGAKVRILRKESYWYNNVGTVAIIEPDTSSYPVLVRFIKVNYSGTNTANFKLEELVSV 61
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: A0A7T8G5J8_SCYLO (Photosystem I reaction center subunit IV n=5 Tax=Scytosiphonaceae TaxID=2891 RepID=A0A7T8G5J8_SCYLO) HSP 1 Score: 104 bits (260), Expect = 2.240e-28 Identity = 49/58 (84.48%), Postives = 54/58 (93.10%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEEL 174 MV +GAKVRILRKESYWYNDIGTV V+E+ SNYP+LVRFVKVNYSGTNTANFK+EEL Sbjct: 2 MVDRGAKVRILRKESYWYNDIGTVAVIEKGGSNYPILVRFVKVNYSGTNTANFKLEEL 59
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: A0A1L2F1M7_9PHAE (PsaE n=14 Tax=Sargassaceae TaxID=3014 RepID=A0A1L2F1M7_9PHAE) HSP 1 Score: 103 bits (257), Expect = 6.440e-28 Identity = 45/59 (76.27%), Postives = 54/59 (91.53%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEELI 177 M+ KG+KVRILRKESYWYND+GTV +EQ SNYP++VRF+KVNYSGTNTANFK+EEL+ Sbjct: 1 MIEKGSKVRILRKESYWYNDLGTVAAIEQGGSNYPIVVRFIKVNYSGTNTANFKLEELV 59
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: A0A8F0JZ58_9PHAE (Photosystem I reaction center subunit IV n=1 Tax=Chorda asiatica TaxID=1281577 RepID=A0A8F0JZ58_9PHAE) HSP 1 Score: 102 bits (254), Expect = 1.800e-27 Identity = 45/59 (76.27%), Postives = 55/59 (93.22%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEELI 177 M+ KG+KVR+LRKESYW+ND+G+VV+VE+ SNYPVLVRF KVNYSGTNTANFK+EEL+ Sbjct: 1 MIEKGSKVRVLRKESYWFNDVGSVVIVEKIASNYPVLVRFTKVNYSGTNTANFKLEELV 59
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Match: A0A6B7EUS6_9PHAE (Photosystem I reaction center subunit IV n=1 Tax=Cladosiphon okamuranus TaxID=309737 RepID=A0A6B7EUS6_9PHAE) HSP 1 Score: 101 bits (251), Expect = 5.170e-27 Identity = 47/61 (77.05%), Postives = 54/61 (88.52%), Query Frame = 1 Query: 1 MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTANFKIEELIDI 183 M+ +GAKVRILRKESYWYNDIGTVV E+ +NYPV+VRFVKVNYSGTNTANFK EEL+ + Sbjct: 1 MLDRGAKVRILRKESYWYNDIGTVVTTEKKAANYPVIVRFVKVNYSGTNTANFKEEELVAV 61 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10147.199.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10147.199.1 >prot_D-dudresnayi_contig10147.199.1 ID=prot_D-dudresnayi_contig10147.199.1|Name=mRNA_D-dudresnayi_contig10147.199.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=62bp MVAKGAKVRILRKESYWYNDIGTVVVVEQSTSNYPVLVRFVKVNYSGTNTback to top mRNA from alignment at D-dudresnayi_contig10147:5811..5996- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10147.199.1 ID=mRNA_D-dudresnayi_contig10147.199.1|Name=mRNA_D-dudresnayi_contig10147.199.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=186bp|location=Sequence derived from alignment at D-dudresnayi_contig10147:5811..5996- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10147:5811..5996- >mRNA_D-dudresnayi_contig10147.199.1 ID=mRNA_D-dudresnayi_contig10147.199.1|Name=mRNA_D-dudresnayi_contig10147.199.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=372bp|location=Sequence derived from alignment at D-dudresnayi_contig10147:5811..5996- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |