prot_C-australica_Contig_9962.1.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_9962.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MDASLIPFILTLLAVGAFAGLIAGLFGIGGGIVMVPALYYVLTALGYEAHAMHAAVGTSLMVIVTTSLRSVAAHAQKGAVDFAVLKGWTPFIVIGALLGSAVADLAPGRALTGLFGAVALLLSAQFFFGRPDWKLADQLPGHPWKALLGGVIGVL20406080100120140Expect = 5.84e-88 / Id = 90.32Expect = 1.13e-75 / Id = 78.95Expect = 1.96e-68 / Id = 77.78Expect = 3.15e-68 / Id = 73.55Expect = 1.28e-64 / Id = 72.79Expect = 1.74e-62 / Id = 71.62Expect = 4.81e-62 / Id = 68.67Expect = 9.23e-60 / Id = 69.23Expect = 6.20e-58 / Id = 66.22Expect = 1.21e-57 / Id = 66.22SequenceA3UK66_9PROTA0A2U2BSR8_9PROTA0A4V3RYU7_9PROTA0A4S2H2Y2_9PROTUPI00038128EEA0A5M6ZCS8_9PROTA0A3T0EAU1_9PROTA0A1G9Q0X2_9PROTQ0AR39_MARMMA0A2D7Y2S7_9PROT
Match NameE-valueIdentityDescription
A3UK66_9PROT5.840e-8890.32Probable membrane transporter protein n=3 Tax=Ocea... [more]
A0A2U2BSR8_9PROT1.130e-7578.95Probable membrane transporter protein n=1 Tax=Mari... [more]
A0A4V3RYU7_9PROT1.960e-6877.78Probable membrane transporter protein n=2 Tax=Mari... [more]
A0A4S2H2Y2_9PROT3.150e-6873.55Probable membrane transporter protein n=1 Tax=Mari... [more]
UPI00038128EE1.280e-6472.79sulfite exporter TauE/SafE family protein n=1 Tax=... [more]
A0A5M6ZCS8_9PROT1.740e-6271.62Probable membrane transporter protein n=2 Tax=Prot... [more]
A0A3T0EAU1_9PROT4.810e-6268.67Probable membrane transporter protein n=4 Tax=Mari... [more]
A0A1G9Q0X2_9PROT9.230e-6069.23Probable membrane transporter protein n=1 Tax=Mari... [more]
Q0AR39_MARMM6.200e-5866.22Probable membrane transporter protein n=3 Tax=Mari... [more]
A0A2D7Y2S7_9PROT1.210e-5766.22Probable membrane transporter protein n=3 Tax=Mari... [more]

Pages

back to top