prot_C-australica_Contig_988.4.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
AKRPRKSDKRCQEEDEGAAVLATARSVTASTSSPSAATSATGAPSAEQYLCTGYHIYTTVEPCMMCAMALLHSRVAM10203040506070Expect = 7.27e-8 / Id = 77.42Expect = 1.04e-7 / Id = 64.29Expect = 2.30e-7 / Id = 69.70Expect = 3.54e-7 / Id = 69.70Expect = 3.56e-7 / Id = 69.70Expect = 3.58e-7 / Id = 73.53Expect = 8.88e-7 / Id = 53.19Expect = 9.11e-7 / Id = 70.97Expect = 1.57e-6 / Id = 74.07Expect = 1.70e-6 / Id = 75.86SequenceUPI00148A7567A0A8K1FQ92_PYTOLA0A0H5BZ50_CYBJNA0A1E4S8G3_CYBJNA0A0B6Y6V9_9EUPUA0A7S3ZUQ9_9STRAA0A7J5Y0E0_DISMAA0A1E3P110_WICAAA0A4P9ZTZ3_9FUNGA0A224XGF7_9HEMI
Match NameE-valueIdentityDescription
UPI00148A75677.270e-877.42probable inactive tRNA-specific adenosine deaminas... [more]
A0A8K1FQ92_PYTOL1.040e-764.29Uncharacterized protein n=1 Tax=Pythium oligandrum... [more]
A0A0H5BZ50_CYBJN2.300e-769.70CMP/dCMP-type deaminase domain-containing protein ... [more]
A0A1E4S8G3_CYBJN3.540e-769.70Cytidine deaminase-like protein n=1 Tax=Cyberlindn... [more]
A0A0B6Y6V9_9EUPU3.560e-769.70CMP/dCMP-type deaminase domain-containing protein ... [more]
A0A7S3ZUQ9_9STRA3.580e-773.53Hypothetical protein n=1 Tax=Pelagomonas calceolat... [more]
A0A7J5Y0E0_DISMA8.880e-753.19CMP/dCMP-type deaminase domain-containing protein ... [more]
A0A1E3P110_WICAA9.110e-770.97CMP/dCMP-type deaminase domain-containing protein ... [more]
A0A4P9ZTZ3_9FUNG1.570e-674.07Cytidine deaminase-like protein (Fragment) n=1 Tax... [more]
A0A224XGF7_9HEMI1.700e-675.86Putative subunit of trna-specific adenosine-34 dea... [more]

Pages

back to top