mRNA_C-australica_Contig_988.4.1 (mRNA) Chrysoparadoxa australica CS_1217
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: UPI00148A7567 (probable inactive tRNA-specific adenosine deaminase-like protein 3 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI00148A7567) HSP 1 Score: 57.4 bits (137), Expect = 7.270e-8 Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 1 Query: 133 SAEQYLCTGYHIYTTVEPCMMCAMALLHSRV 225 SAEQYLCTGY +Y T EPC+MCAMAL+HSR+ Sbjct: 244 SAEQYLCTGYDLYATTEPCVMCAMALVHSRI 274
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A8K1FQ92_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1FQ92_PYTOL) HSP 1 Score: 57.0 bits (136), Expect = 1.040e-7 Identity = 27/42 (64.29%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 97 SPSAXXXXTGAPSAEQYLCTGYHIYTTVEPCMMCAMALLHSR 222 S SA G SAE YLCTGY +Y VEPC+MCAMAL+HSR Sbjct: 248 SASAVTLSNGQASAESYLCTGYDVYVDVEPCVMCAMALIHSR 289
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A0H5BZ50_CYBJN (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / BCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) TaxID=983966 RepID=A0A0H5BZ50_CYBJN) HSP 1 Score: 55.5 bits (132), Expect = 2.300e-7 Identity = 23/33 (69.70%), Postives = 26/33 (78.79%), Query Frame = 1 Query: 130 PSAEQYLCTGYHIYTTVEPCMMCAMALLHSRVA 228 PS YLC YH+YTT EPC MCAMAL+HSR+A Sbjct: 169 PSDHHYLCNNYHVYTTHEPCTMCAMALIHSRIA 201
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A1E4S8G3_CYBJN (Cytidine deaminase-like protein n=1 Tax=Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / BCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) TaxID=983966 RepID=A0A1E4S8G3_CYBJN) HSP 1 Score: 55.5 bits (132), Expect = 3.540e-7 Identity = 23/33 (69.70%), Postives = 26/33 (78.79%), Query Frame = 1 Query: 130 PSAEQYLCTGYHIYTTVEPCMMCAMALLHSRVA 228 PS YLC YH+YTT EPC MCAMAL+HSR+A Sbjct: 227 PSDHHYLCNNYHVYTTHEPCTMCAMALIHSRIA 259
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A0B6Y6V9_9EUPU (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B6Y6V9_9EUPU) HSP 1 Score: 55.5 bits (132), Expect = 3.560e-7 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 127 APSAEQYLCTGYHIYTTVEPCMMCAMALLHSRV 225 AP+AE YLCTGY +Y T EPC+MC+MAL+HSR+ Sbjct: 237 APTAEPYLCTGYDLYLTQEPCVMCSMALVHSRI 269
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A7S3ZUQ9_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S3ZUQ9_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 3.580e-7 Identity = 25/34 (73.53%), Postives = 28/34 (82.35%), Query Frame = 1 Query: 124 GAPSAEQYLCTGYHIYTTVEPCMMCAMALLHSRV 225 GAP +E YLCTG +Y T EPC+MCAMALLHSRV Sbjct: 246 GAPPSEAYLCTGMDVYMTDEPCVMCAMALLHSRV 279
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A7J5Y0E0_DISMA (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Dissostichus mawsoni TaxID=36200 RepID=A0A7J5Y0E0_DISMA) HSP 1 Score: 52.8 bits (125), Expect = 8.880e-7 Identity = 25/47 (53.19%), Postives = 32/47 (68.09%), Query Frame = 1 Query: 85 ASTSSPSAXXXXTGAPSAEQYLCTGYHIYTTVEPCMMCAMALLHSRV 225 A T +P A PS+ Y+CTGY +Y T EPC+MCAMAL+HSR+ Sbjct: 56 ACTFTPPASDTFQSTPSSLPYICTGYDLYVTREPCIMCAMALVHSRI 102
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A1E3P110_WICAA (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8) TaxID=683960 RepID=A0A1E3P110_WICAA) HSP 1 Score: 54.3 bits (129), Expect = 9.110e-7 Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 1 Query: 136 AEQYLCTGYHIYTTVEPCMMCAMALLHSRVA 228 ++ YLC GYH+YTT EPC MCAMAL+HSRV+ Sbjct: 227 SQHYLCYGYHVYTTHEPCSMCAMALIHSRVS 257
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A4P9ZTZ3_9FUNG (Cytidine deaminase-like protein (Fragment) n=1 Tax=Dimargaris cristalligena TaxID=215637 RepID=A0A4P9ZTZ3_9FUNG) HSP 1 Score: 51.6 bits (122), Expect = 1.570e-6 Identity = 20/27 (74.07%), Postives = 25/27 (92.59%), Query Frame = 1 Query: 145 YLCTGYHIYTTVEPCMMCAMALLHSRV 225 YLCTGY +YTT+EPC+MC+MAL HSR+ Sbjct: 60 YLCTGYDVYTTMEPCVMCSMALTHSRI 86
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Match: A0A224XGF7_9HEMI (Putative subunit of trna-specific adenosine-34 deaminase (Fragment) n=1 Tax=Panstrongylus lignarius TaxID=156445 RepID=A0A224XGF7_9HEMI) HSP 1 Score: 53.5 bits (127), Expect = 1.700e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 1 Query: 139 EQYLCTGYHIYTTVEPCMMCAMALLHSRV 225 + YLCTGY++YTT EPC MCAMAL+HSRV Sbjct: 236 DPYLCTGYYVYTTHEPCTMCAMALIHSRV 264 The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_988.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-australica_Contig_988.4.1 >prot_C-australica_Contig_988.4.1 ID=prot_C-australica_Contig_988.4.1|Name=mRNA_C-australica_Contig_988.4.1|organism=Chrysoparadoxa australica CS_1217|type=polypeptide|length=77bp AKRPRKSDKRCQEEDEGAAVLATARSVTASTSSPSAATSATGAPSAEQYLback to top mRNA from alignment at C-australica_Contig_988:16804..17273+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-australica_Contig_988.4.1 ID=mRNA_C-australica_Contig_988.4.1|Name=mRNA_C-australica_Contig_988.4.1|organism=Chrysoparadoxa australica CS_1217|type=mRNA|length=470bp|location=Sequence derived from alignment at C-australica_Contig_988:16804..17273+ (Chrysoparadoxa australica CS_1217)back to top Coding sequence (CDS) from alignment at C-australica_Contig_988:16804..17273+ >mRNA_C-australica_Contig_988.4.1 ID=mRNA_C-australica_Contig_988.4.1|Name=mRNA_C-australica_Contig_988.4.1|organism=Chrysoparadoxa australica CS_1217|type=CDS|length=231bp|location=Sequence derived from alignment at C-australica_Contig_988:16804..17273+ (Chrysoparadoxa australica CS_1217)back to top |