prot_C-australica_Contig_98.10.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_98.10.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MPPPLVDGAVEYEDGTPATVSQMAKDVTCFLQWCAEPEHDVRKAQGMQVILGLLACIALTGYYKRLRWAPLKTRKIE*10203040506070Expect = 4.71e-33 / Id = 75.32Expect = 1.38e-31 / Id = 76.39Expect = 1.44e-31 / Id = 73.68Expect = 4.04e-31 / Id = 71.05Expect = 4.08e-31 / Id = 75.00Expect = 6.02e-31 / Id = 73.61Expect = 4.29e-30 / Id = 71.23Expect = 1.28e-29 / Id = 73.97Expect = 1.40e-29 / Id = 64.94Expect = 2.39e-29 / Id = 73.61SequenceA0A485LA40_9STRAG5AHH7_PHYSPA0A067C0J4_SAPPCA0A835Z587_9STRAH3G7D8_PHYRMA0A0P5MCT1_9CRUSM4C0R6_HYAAEW4G561_9STRAA0A7S1BBA1_9STRAK3X7N2_GLOUD
Match NameE-valueIdentityDescription
A0A485LA40_9STRA4.710e-3375.32Aste57867_18449 protein n=1 Tax=Aphanomyces stella... [more]
G5AHH7_PHYSP1.380e-3176.39Cytochrome c domain-containing protein n=18 Tax=Pe... [more]
A0A067C0J4_SAPPC1.440e-3173.68Cytochrome c domain-containing protein n=4 Tax=Sap... [more]
A0A835Z587_9STRA4.040e-3171.05Cytochrome c1 n=2 Tax=Tribonema minus TaxID=303371... [more]
H3G7D8_PHYRM4.080e-3175.00Cytochrome c domain-containing protein n=2 Tax=Per... [more]
A0A0P5MCT1_9CRUS6.020e-3173.61Cytochrome c1, heme protein, mitochondrial (Fragme... [more]
M4C0R6_HYAAE4.290e-3071.23Cytochrome c domain-containing protein n=7 Tax=Per... [more]
W4G561_9STRA1.280e-2973.97Cytochrome c domain-containing protein n=2 Tax=Aph... [more]
A0A7S1BBA1_9STRA1.400e-2964.94Hypothetical protein n=1 Tax=Corethron hystrix Tax... [more]
K3X7N2_GLOUD2.390e-2973.61Cytochrome c domain-containing protein n=2 Tax=Pyt... [more]

Pages

back to top