prot_C-australica_Contig_978.5.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_978.5.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 4
ZOOM
x 1
POSITION
0
MLSCPVQVLVHGLKGQPEDLNYLKIALDNLGCTGMYVHLAQANVGSTTDGVEQGGHRLANEIRGLKRHLP10203040506070Expect = 5.86e-10 / Id = 51.52Expect = 1.86e-9 / Id = 51.52Expect = 1.28e-8 / Id = 43.94Expect = 1.27e-5 / Id = 44.07SequenceA0A7S3Y223_HETAKA0A7S4DB30_HETAKA0A7S1TBP4_9RHODA0A5J4Z370_PORPP
Match NameE-valueIdentityDescription
A0A7S3Y223_HETAK5.860e-1051.52Hypothetical protein (Fragment) n=1 Tax=Heterosigm... [more]
A0A7S4DB30_HETAK1.860e-951.52Hypothetical protein (Fragment) n=1 Tax=Heterosigm... [more]
A0A7S1TBP4_9RHOD1.280e-843.94Hypothetical protein n=1 Tax=Compsopogon caeruleus... [more]
A0A5J4Z370_PORPP1.270e-544.07Putative lipase n=1 Tax=Porphyridium purpureum Tax... [more]
back to top