mRNA_C-australica_Contig_978.5.1 (mRNA) Chrysoparadoxa australica CS_1217
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-australica_Contig_978.5.1 vs. uniprot
Match: A0A7S3Y223_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y223_HETAK) HSP 1 Score: 60.8 bits (146), Expect = 1.110e-8 Identity = 34/66 (51.52%), Postives = 39/66 (59.09%), Query Frame = 1 Query: 304 VLVHGLKGQPEDLNYLKIALDNLGCTG---MYVHLAQANVGSTTDGVEQGGHRLANEIRGLKRHLP 492 VLVHGL G PEDLNYLK AL+ + VHLA+ N T DGV GG RLA E+R + P Sbjct: 48 VLVHGLAGTPEDLNYLKGALERGAAARGQRVLVHLARCNHRRTRDGVRAGGRRLAQEVRAVVARHP 113
BLAST of mRNA_C-australica_Contig_978.5.1 vs. uniprot
Match: A0A7S4DB30_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DB30_HETAK) HSP 1 Score: 60.8 bits (146), Expect = 3.620e-8 Identity = 34/66 (51.52%), Postives = 39/66 (59.09%), Query Frame = 1 Query: 304 VLVHGLKGQPEDLNYLKIALDNLGCTG---MYVHLAQANVGSTTDGVEQGGHRLANEIRGLKRHLP 492 VLVHGL G PEDLNYLK AL+ + VHLA+ N T DGV GG RLA E+R + P Sbjct: 128 VLVHGLAGTPEDLNYLKGALERGAAARGQRVLVHLARCNHRRTRDGVRAGGRRLAQEVRAVVARHP 193
BLAST of mRNA_C-australica_Contig_978.5.1 vs. uniprot
Match: A0A7S1TBP4_9RHOD (Hypothetical protein n=1 Tax=Compsopogon caeruleus TaxID=31354 RepID=A0A7S1TBP4_9RHOD) HSP 1 Score: 59.3 bits (142), Expect = 2.730e-7 Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 1 Query: 304 VLVHGLKGQPEDLNYLKIALDN---LGCTGMYVHLAQANVGSTTDGVEQGGHRLANEIRGLKRHLP 492 VLVHGL G+PED+ ++ + +G G+ +H NVG TTDGV GG R+A +I G+ R P Sbjct: 122 VLVHGLSGKPEDMGKIEELMRKDAAVGQRGVLIHATDVNVGRTTDGVRNGGKRVAGDIVGMVRKYP 187 The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_978.5.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-australica_Contig_978.5.1 >prot_C-australica_Contig_978.5.1 ID=prot_C-australica_Contig_978.5.1|Name=mRNA_C-australica_Contig_978.5.1|organism=Chrysoparadoxa australica CS_1217|type=polypeptide|length=70bp MLSCPVQVLVHGLKGQPEDLNYLKIALDNLGCTGMYVHLAQANVGSTTDGback to top mRNA from alignment at C-australica_Contig_978:9226..10001- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-australica_Contig_978.5.1 ID=mRNA_C-australica_Contig_978.5.1|Name=mRNA_C-australica_Contig_978.5.1|organism=Chrysoparadoxa australica CS_1217|type=mRNA|length=776bp|location=Sequence derived from alignment at C-australica_Contig_978:9226..10001- (Chrysoparadoxa australica CS_1217)back to top Coding sequence (CDS) from alignment at C-australica_Contig_978:9226..10001- >mRNA_C-australica_Contig_978.5.1 ID=mRNA_C-australica_Contig_978.5.1|Name=mRNA_C-australica_Contig_978.5.1|organism=Chrysoparadoxa australica CS_1217|type=CDS|length=210bp|location=Sequence derived from alignment at C-australica_Contig_978:9226..10001- (Chrysoparadoxa australica CS_1217)back to top |