prot_C-australica_Contig_10321.1.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_10321.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 7
ZOOM
x 1
POSITION
0
MEDWKYSSFQEYTDPSRNKICDKKLAYKLLEINEEVFYEESYKIIDFKGFK*5101520253035404550Expect = 6.60e-7 / Id = 50.00Expect = 9.20e-7 / Id = 51.11Expect = 9.30e-7 / Id = 44.44Expect = 1.79e-6 / Id = 47.92Expect = 1.79e-6 / Id = 47.83Expect = 2.57e-6 / Id = 45.83Expect = 9.41e-6 / Id = 40.91SequenceUPI0019CA3A53UPI0019AB059EL8JGS3_9BACTA0A1X7IJ02_9BACTA0A4Q1CJM6_9BACTA0A496ZVR9_9BACTA0A150Y3U5_9BACT
Match NameE-valueIdentityDescription
UPI0019CA3A536.600e-750.00Transposase n=1 Tax=Sphingobacteriaceae bacterium ... [more]
UPI0019AB059E9.200e-751.11Transposase n=1 Tax=Chitinophagaceae bacterium Tax... [more]
L8JGS3_9BACT9.300e-744.44Putative transposase n=1 Tax=Fulvivirga imtechensi... [more]
A0A1X7IJ02_9BACT1.790e-647.92Putative transposase n=1 Tax=Marivirga sericea Tax... [more]
A0A4Q1CJM6_9BACT1.790e-647.83Transposase n=1 Tax=Lacibacter luteus TaxID=250871... [more]
A0A496ZVR9_9BACT2.570e-645.83Transposase n=1 Tax=Candidatus Cloacimonetes bacte... [more]
A0A150Y3U5_9BACT9.410e-640.91Transposase n=2 Tax=Roseivirga seohaensis TaxID=19... [more]
back to top