prot_C-australica_Contig_10062.1.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_10062.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MKRLPMRKIREALRLRAEGLSGRRVAQSLSLGRATVSEYFRRADVAGLAWPLADDLSDTALEHRLYPHEPGASARAIAQPNWAYVHGELRRKGVTLALFWEEYRAIHPYGYGYSRYCELYTRREGWLSPVMRQRHPAGERLFVDYAGHTVDVV*20406080100120140Expect = 1.90e-86 / Id = 85.14Expect = 1.78e-84 / Id = 84.31Expect = 2.63e-81 / Id = 78.43Expect = 2.50e-78 / Id = 78.43Expect = 1.04e-72 / Id = 75.00Expect = 2.94e-70 / Id = 72.37Expect = 4.08e-69 / Id = 73.65Expect = 1.91e-68 / Id = 67.32Expect = 8.67e-66 / Id = 71.05Expect = 1.08e-65 / Id = 64.71SequenceUPI001652F7ECA0A3D2EQT6_9PROTA0A285MB90_9HYPHA0A285LZA6_9HYPHUPI000685C4B7A0A5R8Y5E6_9HYPHA0A1H1F7G0_9HYPHA0A238VL59_9RHOBA0A662DS58_9ACTNA0A1X4IMF3_9RHOB
Match NameE-valueIdentityDescription
UPI001652F7EC1.900e-8685.14hypothetical protein n=1 Tax=Roseobacter litoralis... [more]
A0A3D2EQT6_9PROT1.780e-8484.31IS21 family transposase n=1 Tax=Alphaproteobacteri... [more]
A0A285MB90_9HYPH2.630e-8178.43HTH IS408-type domain-containing protein n=2 Tax=C... [more]
A0A285LZA6_9HYPH2.500e-7878.43Transposase n=2 Tax=Cohaesibacter sp. ES.047 TaxID... [more]
UPI000685C4B71.040e-7275.00IS21 family transposase n=1 Tax=Octadecabacter arc... [more]
A0A5R8Y5E6_9HYPH2.940e-7072.37IS21 family transposase n=1 Tax=Cohaesibacter sp. ... [more]
A0A1H1F7G0_9HYPH4.080e-6973.65Transposase n=2 Tax=Pseudovibrio sp. Tun.PSC04-5.I... [more]
A0A238VL59_9RHOB1.910e-6867.32HTH IS408-type domain-containing protein n=1 Tax=P... [more]
A0A662DS58_9ACTN8.670e-6671.05IS21 family transposase n=2 Tax=Bacteria TaxID=2 R... [more]
A0A1X4IMF3_9RHOB1.080e-6564.71IS21 family transposase (Fragment) n=1 Tax=Pseudor... [more]

Pages

back to top