mRNA_C-australica_Contig_1026.3.1 (mRNA) Chrysoparadoxa australica CS_1217
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-australica_Contig_1026.3.1 vs. uniprot
Match: A0A835ZAD4_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZAD4_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 5.630e-10 Identity = 37/81 (45.68%), Postives = 55/81 (67.90%), Query Frame = 1 Query: 121 SQESAEEEVLFTSILSEPIRTLKRVSITSCGMSLC-MPIALLASSSSVPLSGQIAISATTIAVAVSTTGLLHFFTSNLIHR 360 S + +EE+L+ L+ PI+TLKRVSIT+C MS+ P+ L+ + SVPLSGQIA++ + AV +T LLH+ T +H+ Sbjct: 41 STNARKEELLYIGPLTAPIKTLKRVSITTCAMSMIGTPLLLVLGNDSVPLSGQIAVTGVALTAAVGSTALLHWCTRPYVHK 121 The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_1026.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-australica_Contig_1026.3.1 >prot_C-australica_Contig_1026.3.1 ID=prot_C-australica_Contig_1026.3.1|Name=mRNA_C-australica_Contig_1026.3.1|organism=Chrysoparadoxa australica CS_1217|type=polypeptide|length=111bp MLWCTLRLGVTRRPIATFRRPFCQSQAFPKSQESAEEEVLFTSILSEPIRback to top mRNA from alignment at C-australica_Contig_1026:5366..5903- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-australica_Contig_1026.3.1 ID=mRNA_C-australica_Contig_1026.3.1|Name=mRNA_C-australica_Contig_1026.3.1|organism=Chrysoparadoxa australica CS_1217|type=mRNA|length=538bp|location=Sequence derived from alignment at C-australica_Contig_1026:5366..5903- (Chrysoparadoxa australica CS_1217)back to top Coding sequence (CDS) from alignment at C-australica_Contig_1026:5366..5903- >mRNA_C-australica_Contig_1026.3.1 ID=mRNA_C-australica_Contig_1026.3.1|Name=mRNA_C-australica_Contig_1026.3.1|organism=Chrysoparadoxa australica CS_1217|type=CDS|length=333bp|location=Sequence derived from alignment at C-australica_Contig_1026:5366..5903- (Chrysoparadoxa australica CS_1217)back to top |