prot_C-tenellus_contig9805.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9805.1.1 vs. uniprot
Match: A0A6H5L4M0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4M0_9PHAE) HSP 1 Score: 74.7 bits (182), Expect = 2.490e-14 Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 0 Query: 1 WRNQLWQPRAFFWHEVNYLEKMTKDTEFLLSDSGQSMLASVGLDVTDLVRHLV 53 WR LWQPRAF W VNYLEKM++DT FL S G+S+LASVGL+ D+V LV Sbjct: 310 WRTNLWQPRAFCWRGVNYLEKMSQDTIFLRSPVGKSLLASVGLEAEDMVSRLV 362
BLAST of mRNA_C-tenellus_contig9805.1.1 vs. uniprot
Match: D7FNH8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNH8_ECTSI) HSP 1 Score: 70.1 bits (170), Expect = 1.050e-12 Identity = 32/48 (66.67%), Postives = 36/48 (75.00%), Query Frame = 0 Query: 1 WRNQLWQPRAFFWHEVNYLEKMTKDTEFLLSDSGQSMLASVGLDVTDL 48 WR LWQPRAF W VNYLEKM +DT FL S GQS+LASVGL+ D+ Sbjct: 313 WRTNLWQPRAFCWRGVNYLEKMWQDTIFLRSPVGQSLLASVGLEAKDM 360 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9805.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9805.1.1 ID=prot_C-tenellus_contig9805.1.1|Name=mRNA_C-tenellus_contig9805.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=54bpback to top |