prot_C-tenellus_contig9718.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9718.1.1 vs. uniprot
Match: A0A6H5L0B7_9PHAE (t-SNARE coiled-coil homology domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0B7_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 9.040e-8 Identity = 25/40 (62.50%), Postives = 33/40 (82.50%), Query Frame = 0 Query: 1 MLHRMVQQLGSTRDTPELRGQLRCQVDVVKELGAQIEGEV 40 +LHRMVQQLG+ RDT ELRGQ RCQ+ V+ EL +I+G++ Sbjct: 136 LLHRMVQQLGTARDTGELRGQCRCQLQVIDELREKIQGQM 175
BLAST of mRNA_C-tenellus_contig9718.1.1 vs. uniprot
Match: D7FPU1_ECTSI (Soluble NSF Attachment Protein (SNAP) Receptor (SNARE) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPU1_ECTSI) HSP 1 Score: 53.1 bits (126), Expect = 5.430e-7 Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 1 MLHRMVQQLGSTRDTPELRGQLRCQVDVVKELGAQIEGEV 40 +LHRMVQQLG+ RDT ELRGQ RCQ+ V+ EL +I+ ++ Sbjct: 9 LLHRMVQQLGTARDTGELRGQCRCQLQVIGELREKIQAQM 48 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9718.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9718.1.1 ID=prot_C-tenellus_contig9718.1.1|Name=mRNA_C-tenellus_contig9718.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=50bpback to top |