mRNA_C-tenellus_contig8087.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8087.1.1 vs. uniprot
Match: A0A7S3ZVE2_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S3ZVE2_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 2.630e-8 Identity = 27/54 (50.00%), Postives = 33/54 (61.11%), Query Frame = 1 Query: 4 CLLRYCQCFAGQAPCSTACNCLNCHNTLAHSRERQRAMTGLLVRNPNAFATKFK 165 CL YC CFA C CNC++CHN LAH++ER A+ L +NP AF K K Sbjct: 399 CLKLYCDCFAAGRWCK-GCNCVDCHNDLAHAKERDEAIRATLEKNPKAFRAKVK 451
BLAST of mRNA_C-tenellus_contig8087.1.1 vs. uniprot
Match: A0A6G1SKJ5_9ACAR (Protein lin-54 n=1 Tax=Aceria tosichella TaxID=561515 RepID=A0A6G1SKJ5_9ACAR) HSP 1 Score: 53.5 bits (127), Expect = 8.140e-7 Identity = 27/53 (50.94%), Postives = 32/53 (60.38%), Query Frame = 1 Query: 4 CLLRYCQCFAGQAPCSTACNCLNCHNTLAHSRERQRAMTGLLVRNPNAFATKF 162 CL YC CFA CS CNC NC N+L +ERQ+A++ L RNP AF K Sbjct: 177 CLKLYCDCFANGEFCS-GCNCTNCSNSLDKEKERQKAISQCLERNPEAFRPKI 228
BLAST of mRNA_C-tenellus_contig8087.1.1 vs. uniprot
Match: A0A1R2B5P7_9CILI (CRC domain-containing protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2B5P7_9CILI) HSP 1 Score: 47.0 bits (110), Expect = 8.060e-5 Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 1 Query: 4 CLLRYCQCFAGQAPCSTACNCLNCHNTLAHSRERQRAMTGLLVRNPNAFAT-KFKTE 171 CL YC+CF+ C CNC+NC N + R +A+T LL RN AFAT K KT+ Sbjct: 61 CLKLYCECFSKGRYC-IGCNCINCFNVPEYESIRNKAVTHLLHRNSEAFATEKNKTK 116 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8087.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig8087.1.1 >prot_C-tenellus_contig8087.1.1 ID=prot_C-tenellus_contig8087.1.1|Name=mRNA_C-tenellus_contig8087.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=57bp MCLLRYCQCFAGQAPCSTACNCLNCHNTLAHSRERQRAMTGLLVRNPNAFback to top mRNA from alignment at C-tenellus_contig8087:4348..4518+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig8087.1.1 ID=mRNA_C-tenellus_contig8087.1.1|Name=mRNA_C-tenellus_contig8087.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=171bp|location=Sequence derived from alignment at C-tenellus_contig8087:4348..4518+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig8087:4348..4518+ >mRNA_C-tenellus_contig8087.1.1 ID=mRNA_C-tenellus_contig8087.1.1|Name=mRNA_C-tenellus_contig8087.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=171bp|location=Sequence derived from alignment at C-tenellus_contig8087:4348..4518+ (Choristocarpus tenellus KU2346)back to top |