mRNA_C-tenellus_contig7903.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7903.1.1 vs. uniprot
Match: D8LIY1_ECTSI (ClpS domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LIY1_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 6.960e-7 Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 2 Query: 500 EVEAKQEIKAEEEWRVILHNDEIHTFDYVTQSITK 604 EV+ K+E+ E+ WRVILHNDEIHTFDYVTQSITK Sbjct: 100 EVDNKEELDKEQWWRVILHNDEIHTFDYVTQSITK 134
BLAST of mRNA_C-tenellus_contig7903.1.1 vs. uniprot
Match: A0A1Z5JEC0_FISSO (ClpS domain-containing protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JEC0_FISSO) HSP 1 Score: 53.5 bits (127), Expect = 1.500e-5 Identity = 36/91 (39.56%), Postives = 53/91 (58.24%), Query Frame = 2 Query: 338 LSPVRG--QLPRGE*SQLC*CRPLERLQERKLGPRSS*KRELLRKWRCVELFHVLREVEAKQEIKAEEEWRVILHNDEIHTFDYVTQSITK 604 L+PV G LPR S L +RL + + S K +K + V++ E +A+++ K EE WRV+LHNDE+HTF+YV +S+TK Sbjct: 16 LTPVHGFAVLPRSS-STLT---SPQRLSDTSIYMSSVEKSSTTKKGKSVQVIDKT-ETKAEEQKKKEEMWRVVLHNDEVHTFNYVVRSLTK 101
BLAST of mRNA_C-tenellus_contig7903.1.1 vs. uniprot
Match: A0A835ZHY3_9STRA (Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZHY3_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 3.850e-5 Identity = 23/34 (67.65%), Postives = 29/34 (85.29%), Query Frame = 2 Query: 503 VEAKQEIKAEEEWRVILHNDEIHTFDYVTQSITK 604 V+ K+++ E+ WRVILHND+IHTFDYVT SITK Sbjct: 20 VQRKEQLDKEKWWRVILHNDDIHTFDYVTLSITK 53
BLAST of mRNA_C-tenellus_contig7903.1.1 vs. uniprot
Match: A0A835ZBL6_9STRA (Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBL6_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 4.290e-5 Identity = 23/35 (65.71%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 500 EVEAKQEIKAEEEWRVILHNDEIHTFDYVTQSITK 604 +V+ K+++ E+ WRVILHND+IHTFDYVT SITK Sbjct: 66 QVQRKEQLDKEKWWRVILHNDDIHTFDYVTLSITK 100
BLAST of mRNA_C-tenellus_contig7903.1.1 vs. uniprot
Match: A0A7S2WJ96_9STRA (Hypothetical protein n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2WJ96_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 4.600e-5 Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 2 Query: 500 EVEAKQEIKAEEEWRVILHNDEIHTFDYVTQSITK 604 E E+K E K EE+WRV+LHNDE+HTF+YV QS+ K Sbjct: 89 ETESKAEEKNEEQWRVVLHNDEVHTFNYVIQSLCK 123 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7903.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig7903.1.1 >prot_C-tenellus_contig7903.1.1 ID=prot_C-tenellus_contig7903.1.1|Name=mRNA_C-tenellus_contig7903.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=138bp MPLGSSPCVQSFAFLTFAKRDVTTHRSETCGSFVGQIVVDRGMGPMWASFback to top mRNA from alignment at C-tenellus_contig7903:917..3217- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig7903.1.1 ID=mRNA_C-tenellus_contig7903.1.1|Name=mRNA_C-tenellus_contig7903.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=2301bp|location=Sequence derived from alignment at C-tenellus_contig7903:917..3217- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig7903:917..3217- >mRNA_C-tenellus_contig7903.1.1 ID=mRNA_C-tenellus_contig7903.1.1|Name=mRNA_C-tenellus_contig7903.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=414bp|location=Sequence derived from alignment at C-tenellus_contig7903:917..3217- (Choristocarpus tenellus KU2346)back to top |