prot_C-tenellus_contig7830.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: C1MT94_MICPC (SNF2 super family (Fragment) n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1MT94_MICPC) HSP 1 Score: 62.4 bits (150), Expect = 4.180e-10 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NPAVE+QA+DRVHRLGQT VTV RF DT+E+KMLELQ Sbjct: 772 NPAVEEQAMDRVHRLGQTKDVTVVRFAATDTIEEKMLELQ 811
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A8K1CQ45_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CQ45_PYTOL) HSP 1 Score: 62.4 bits (150), Expect = 4.180e-10 Identity = 31/40 (77.50%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NP VEDQAIDRVHRLGQT V VKR+VV DTVED +L+LQ Sbjct: 1020 NPGVEDQAIDRVHRLGQTRDVIVKRYVVEDTVEDMILQLQ 1059
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A6H5KHD4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KHD4_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 4.180e-10 Identity = 31/40 (77.50%), Postives = 35/40 (87.50%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NPAVE+QAIDR+HRLGQ V+VKRFVV+ TVEDKML LQ Sbjct: 1545 NPAVEEQAIDRIHRLGQLNEVSVKRFVVSGTVEDKMLALQ 1584
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: H3GRS2_PHYRM (RanBP-type and C3HC4-type zinc finger-containing protein 1 n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GRS2_PHYRM) HSP 1 Score: 62.0 bits (149), Expect = 5.710e-10 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NP VEDQA+DRVHRLGQT V VKR+VV DTVED +L+LQ Sbjct: 994 NPGVEDQAVDRVHRLGQTQDVIVKRYVVEDTVEDMILQLQ 1033
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A6A3Z681_9STRA (RanBP-type and C3HC4-type zinc finger-containing protein 1 n=6 Tax=Phytophthora TaxID=4783 RepID=A0A6A3Z681_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 5.710e-10 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NP VEDQA+DRVHRLGQT V VKR+VV DTVED +L+LQ Sbjct: 1016 NPGVEDQAVDRVHRLGQTQDVIVKRYVVQDTVEDMILQLQ 1055
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A2K1IG02_PHYPA (Uncharacterized protein n=2 Tax=Physcomitrium patens TaxID=3218 RepID=A0A2K1IG02_PHYPA) HSP 1 Score: 61.6 bits (148), Expect = 7.810e-10 Identity = 29/40 (72.50%), Postives = 35/40 (87.50%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NPAVE+QA+DRVHRLGQT VTV R +V DT+ED++LELQ Sbjct: 810 NPAVEEQAMDRVHRLGQTRDVTVVRLIVTDTIEDRILELQ 849
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A662XF88_9STRA (RanBP-type and C3HC4-type zinc finger-containing protein 1 n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XF88_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 7.810e-10 Identity = 29/40 (72.50%), Postives = 35/40 (87.50%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NP VE+QA+DRVHRLGQT V VKR+VV+DTVED +L+LQ Sbjct: 995 NPGVEEQAVDRVHRLGQTRDVLVKRYVVSDTVEDMLLQLQ 1034
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A662Y6B2_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662Y6B2_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 7.810e-10 Identity = 29/40 (72.50%), Postives = 35/40 (87.50%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NP VE+QA+DRVHRLGQT V V+R+VV+DTVED ML+LQ Sbjct: 1014 NPGVEEQAVDRVHRLGQTQDVLVRRYVVSDTVEDMMLQLQ 1053
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A3F2RHC6_9STRA (Helicase C-terminal domain-containing protein n=1 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3F2RHC6_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 1.140e-9 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NP VE+QAIDRVHRLGQT V VKR+VV DTVED +L+LQ Sbjct: 165 NPGVEEQAIDRVHRLGQTRDVMVKRYVVNDTVEDMILQLQ 204
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Match: A0A2P4YH81_9STRA (DNA repair protein RAD5, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin, p n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4YH81_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 1.200e-9 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 NPAVEDQAIDRVHRLGQTLAVTVKRFVVADTVEDKMLELQ 40 NP VE+QAIDRVHRLGQT V VKR+VV DTVED +L+LQ Sbjct: 172 NPGVEEQAIDRVHRLGQTQDVIVKRYVVNDTVEDMILQLQ 211 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7830.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7830.1.1 ID=prot_C-tenellus_contig7830.1.1|Name=mRNA_C-tenellus_contig7830.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=48bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|