mRNA_C-tenellus_contig7521.4.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7521.4.1 vs. uniprot
Match: D8LME5_ECTSI (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LME5_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 3.300e-18 Identity = 38/56 (67.86%), Postives = 46/56 (82.14%), Query Frame = 1 Query: 22 PEWALNLSLTWEGAVLEDVELRHDLLGSLLGLPVDLPYAHIRKATLHIPWYTLFLG 189 PE +L+LSL WEG VL+DVELR D L LLGLPVD+P+A +R+A LH+PWYTL LG Sbjct: 191 PESSLDLSLRWEGVVLKDVELRRDFLSELLGLPVDVPHAFVRRAVLHLPWYTLLLG 246 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7521.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig7521.4.1 >prot_C-tenellus_contig7521.4.1 ID=prot_C-tenellus_contig7521.4.1|Name=mRNA_C-tenellus_contig7521.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=64bp GGGRGREPEWALNLSLTWEGAVLEDVELRHDLLGSLLGLPVDLPYAHIRKback to top mRNA from alignment at C-tenellus_contig7521:6029..6220+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig7521.4.1 ID=mRNA_C-tenellus_contig7521.4.1|Name=mRNA_C-tenellus_contig7521.4.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=192bp|location=Sequence derived from alignment at C-tenellus_contig7521:6029..6220+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig7521:6029..6220+ >mRNA_C-tenellus_contig7521.4.1 ID=mRNA_C-tenellus_contig7521.4.1|Name=mRNA_C-tenellus_contig7521.4.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=192bp|location=Sequence derived from alignment at C-tenellus_contig7521:6029..6220+ (Choristocarpus tenellus KU2346)back to top |