prot_C-tenellus_contig9848.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A6H5JYC7_9PHAE (Metallophos domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYC7_9PHAE) HSP 1 Score: 110 bits (276), Expect = 5.710e-28 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0 Query: 1 MVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVLSA 62 MV+LLERCGYR+G +EDRERFSVVL GDLVNKGP S +V+RTAREEGFLAVRGNHDNF L+A Sbjct: 99 MVSLLERCGYRLGNKEDRERFSVVLAGDLVNKGPGSVDVVRTAREEGFLAVRGNHDNFALAA 160
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A084SKV9_9DELT (Metallophosphatase n=3 Tax=Archangium TaxID=47 RepID=A0A084SKV9_9DELT) HSP 1 Score: 71.6 bits (174), Expect = 1.020e-13 Identity = 39/58 (67.24%), Postives = 40/58 (68.97%), Query Frame = 0 Query: 3 ALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 ALL CGYR G R VVLVGDLV KGP SA V+R ARE GFLAVRGNHD VL Sbjct: 19 ALLHACGYRRGER-------VVLVGDLVAKGPDSAGVVRRAREHGFLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A2T4VNU1_VITXG (Metallophosphatase n=1 Tax=Vitiosangium sp. (strain GDMCC 1.1324) TaxID=2138576 RepID=A0A2T4VNU1_VITXG) HSP 1 Score: 70.1 bits (170), Expect = 3.720e-13 Identity = 38/58 (65.52%), Postives = 40/58 (68.97%), Query Frame = 0 Query: 3 ALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 ALL CGYR G R VVLVGDLV KGP SA V+R ARE+G LAVRGNHD VL Sbjct: 19 ALLRECGYRQGDR-------VVLVGDLVAKGPDSAGVVRRAREQGMLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: S9PC14_9DELT (Bis(5'-nucleosyl)-tetraphosphatase, symmetrical n=4 Tax=Cystobacter TaxID=42 RepID=S9PC14_9DELT) HSP 1 Score: 69.3 bits (168), Expect = 7.530e-13 Identity = 38/58 (65.52%), Postives = 40/58 (68.97%), Query Frame = 0 Query: 3 ALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 ALLE CG+R G R VVLVGDLV KGP SA V+R ARE G LAVRGNHD VL Sbjct: 19 ALLEECGHRPGDR-------VVLVGDLVAKGPDSAGVVRRARERGMLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: UPI001F297D89 (metallophosphoesterase n=1 Tax=Myxococcus stipitatus TaxID=83455 RepID=UPI001F297D89) HSP 1 Score: 69.3 bits (168), Expect = 7.640e-13 Identity = 38/58 (65.52%), Postives = 41/58 (70.69%), Query Frame = 0 Query: 3 ALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 ALL CG+R G R VVLVGDLV KGP SA V+R ARE+GFLAVRGNHD VL Sbjct: 18 ALLAACGWRRGER-------VVLVGDLVAKGPDSAGVVRRAREQGFLAVRGNHDAHVL 68
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: UPI00193B9ED6 (metallophosphoesterase n=1 Tax=Archangium violaceum TaxID=83451 RepID=UPI00193B9ED6) HSP 1 Score: 67.0 bits (162), Expect = 5.530e-12 Identity = 37/60 (61.67%), Postives = 39/60 (65.00%), Query Frame = 0 Query: 1 MVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 + ALL C YR G R VVLVGDLV KGP SA V+R ARE G LAVRGNHD VL Sbjct: 17 LEALLRECDYRPGDR-------VVLVGDLVAKGPDSAGVVRLARERGLLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: UPI00195018B9 (metallophosphoesterase n=1 Tax=Archangium violaceum TaxID=83451 RepID=UPI00195018B9) HSP 1 Score: 66.6 bits (161), Expect = 7.740e-12 Identity = 37/58 (63.79%), Postives = 39/58 (67.24%), Query Frame = 0 Query: 3 ALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 ALLE CGYR G R VVLVGDLV KGP SA V+R AR+ LAVRGNHD VL Sbjct: 19 ALLEECGYRKGDR-------VVLVGDLVAKGPDSAGVVRRARKRRLLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A848LJY5_9DELT (Serine/threonine protein phosphatase n=7 Tax=Myxococcaceae TaxID=31 RepID=A0A848LJY5_9DELT) HSP 1 Score: 66.2 bits (160), Expect = 1.130e-11 Identity = 38/58 (65.52%), Postives = 41/58 (70.69%), Query Frame = 0 Query: 3 ALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 ALL CG+R +DR VVLVGDLV KGP SA V+R ARE GFLAVRGNHD VL Sbjct: 18 ALLSECGWRP---DDR----VVLVGDLVAKGPDSAGVVRRARERGFLAVRGNHDAHVL 68
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: UPI001EF90FB3 (metallophosphoesterase n=1 Tax=Archangium primigenium TaxID=2792470 RepID=UPI001EF90FB3) HSP 1 Score: 65.9 bits (159), Expect = 1.190e-11 Identity = 36/57 (63.16%), Postives = 38/57 (66.67%), Query Frame = 0 Query: 4 LLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 +LE C YR G R VVLVGDLV KGP SA V+R ARE G LAVRGNHD VL Sbjct: 1 MLEVCAYRPGER-------VVLVGDLVAKGPDSAGVLRRARERGMLAVRGNHDEHVL 50
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A511HCG6_9DELT (Metallophos domain-containing protein n=12 Tax=Myxococcaceae TaxID=31 RepID=A0A511HCG6_9DELT) HSP 1 Score: 64.3 bits (155), Expect = 5.950e-11 Identity = 37/58 (63.79%), Postives = 42/58 (72.41%), Query Frame = 0 Query: 3 ALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 60 ALL +C +R +DR VVLVGDLV KGP SA V+R ARE+GFLAVRGNHD VL Sbjct: 18 ALLTQCAWRP---DDR----VVLVGDLVAKGPDSAGVVRRAREKGFLAVRGNHDAHVL 68 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9848.1.1 ID=prot_C-tenellus_contig9848.1.1|Name=mRNA_C-tenellus_contig9848.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=62bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|