mRNA_C-tenellus_contig9848.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A6H5JYC7_9PHAE (Metallophos domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYC7_9PHAE) HSP 1 Score: 132 bits (333), Expect = 3.130e-31 Identity = 60/76 (78.95%), Postives = 70/76 (92.11%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVLSA 1474 +VI+VGD+HGC+ EMV+LLERCGYR+G +EDRERFSVVL GDLVNKGP S +V+RTAREEGFLAVRGNHDNF L+A Sbjct: 85 EVIVVGDIHGCYGEMVSLLERCGYRLGNKEDRERFSVVLAGDLVNKGPGSVDVVRTAREEGFLAVRGNHDNFALAA 160
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A084SKV9_9DELT (Metallophosphatase n=3 Tax=Archangium TaxID=47 RepID=A0A084SKV9_9DELT) HSP 1 Score: 90.1 bits (222), Expect = 5.970e-17 Identity = 46/74 (62.16%), Postives = 52/74 (70.27%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 1468 + + +GDVHGC +E+ ALL CGYR G R VVLVGDLV KGP SA V+R ARE GFLAVRGNHD VL Sbjct: 3 RTLFIGDVHGCAEELDALLHACGYRRGER-------VVLVGDLVAKGPDSAGVVRRAREHGFLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A2T4VNU1_VITXG (Metallophosphatase n=1 Tax=Vitiosangium sp. (strain GDMCC 1.1324) TaxID=2138576 RepID=A0A2T4VNU1_VITXG) HSP 1 Score: 88.6 bits (218), Expect = 1.890e-16 Identity = 45/74 (60.81%), Postives = 52/74 (70.27%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 1468 + + +GDVHGC +E+ ALL CGYR G R VVLVGDLV KGP SA V+R ARE+G LAVRGNHD VL Sbjct: 3 RTLFIGDVHGCAEELDALLRECGYRQGDR-------VVLVGDLVAKGPDSAGVVRRAREQGMLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: S9PC14_9DELT (Bis(5'-nucleosyl)-tetraphosphatase, symmetrical n=4 Tax=Cystobacter TaxID=42 RepID=S9PC14_9DELT) HSP 1 Score: 87.8 bits (216), Expect = 3.660e-16 Identity = 45/74 (60.81%), Postives = 52/74 (70.27%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 1468 + + +GDVHGC +E+ ALLE CG+R G R VVLVGDLV KGP SA V+R ARE G LAVRGNHD VL Sbjct: 3 RTLFIGDVHGCAEELDALLEECGHRPGDR-------VVLVGDLVAKGPDSAGVVRRARERGMLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: R1C2Y5_EMIHU (Metallophos domain-containing protein (Fragment) n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1C2Y5_EMIHU) HSP 1 Score: 85.5 bits (210), Expect = 6.140e-16 Identity = 44/76 (57.89%), Postives = 51/76 (67.11%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVLSA 1474 + ILVGDVHGC DE+ +LL+ CG+ D VVLVGDLVNKGP SAE + ARE GF VRGNHD+ L A Sbjct: 37 RTILVGDVHGCLDELKSLLQACGF------DASTDHVVLVGDLVNKGPHSAETVAYARESGFACVRGNHDDAALFA 106
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: UPI001F297D89 (metallophosphoesterase n=1 Tax=Myxococcus stipitatus TaxID=83455 RepID=UPI001F297D89) HSP 1 Score: 87.0 bits (214), Expect = 6.920e-16 Identity = 45/74 (60.81%), Postives = 52/74 (70.27%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 1468 + + +GDVHGC E+ ALL CG+R G R VVLVGDLV KGP SA V+R ARE+GFLAVRGNHD VL Sbjct: 2 RTLFIGDVHGCAQELDALLAACGWRRGER-------VVLVGDLVAKGPDSAGVVRRAREQGFLAVRGNHDAHVL 68
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: UPI00193B9ED6 (metallophosphoesterase n=1 Tax=Archangium violaceum TaxID=83451 RepID=UPI00193B9ED6) HSP 1 Score: 86.3 bits (212), Expect = 1.210e-15 Identity = 45/74 (60.81%), Postives = 50/74 (67.57%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 1468 + I +GDVHGC +E+ ALL C YR G R VVLVGDLV KGP SA V+R ARE G LAVRGNHD VL Sbjct: 3 RTIFIGDVHGCAEELEALLRECDYRPGDR-------VVLVGDLVAKGPDSAGVVRLARERGLLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: UPI00195018B9 (metallophosphoesterase n=1 Tax=Archangium violaceum TaxID=83451 RepID=UPI00195018B9) HSP 1 Score: 85.9 bits (211), Expect = 1.640e-15 Identity = 45/74 (60.81%), Postives = 51/74 (68.92%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 1468 + I +GDVHGC +E+ ALLE CGYR G R VVLVGDLV KGP SA V+R AR+ LAVRGNHD VL Sbjct: 3 RTIFIGDVHGCAEELDALLEECGYRKGDR-------VVLVGDLVAKGPDSAGVVRRARKRRLLAVRGNHDEHVL 69
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: A0A848LJY5_9DELT (Serine/threonine protein phosphatase n=7 Tax=Myxococcaceae TaxID=31 RepID=A0A848LJY5_9DELT) HSP 1 Score: 84.7 bits (208), Expect = 4.390e-15 Identity = 45/74 (60.81%), Postives = 53/74 (71.62%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVL 1468 + + +GDVHGC +E+ ALL CG+R +DR VVLVGDLV KGP SA V+R ARE GFLAVRGNHD VL Sbjct: 2 RTLFIGDVHGCAEELDALLSECGWRP---DDR----VVLVGDLVAKGPDSAGVVRRARERGFLAVRGNHDAHVL 68
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Match: R1ELE4_EMIHU (Metallophos domain-containing protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1ELE4_EMIHU) HSP 1 Score: 85.5 bits (210), Expect = 7.770e-15 Identity = 44/76 (57.89%), Postives = 51/76 (67.11%), Query Frame = 2 Query: 1247 QVILVGDVHGCHDEMVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAVRGNHDNFVLSA 1474 + ILVGDVHGC DE+ +LL+ CG+ D VVLVGDLVNKGP SAE + ARE GF VRGNHD+ L A Sbjct: 55 RTILVGDVHGCLDELKSLLQACGF------DASTDHVVLVGDLVNKGPHSAETVAYARESGFACVRGNHDDAALFA 124 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9848.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9848.1.1 >prot_C-tenellus_contig9848.1.1 ID=prot_C-tenellus_contig9848.1.1|Name=mRNA_C-tenellus_contig9848.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=62bp MVALLERCGYRVGRREDRERFSVVLVGDLVNKGPKSAEVIRTAREEGFLAback to top mRNA from alignment at C-tenellus_contig9848:150..2432- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9848.1.1 ID=mRNA_C-tenellus_contig9848.1.1|Name=mRNA_C-tenellus_contig9848.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=2283bp|location=Sequence derived from alignment at C-tenellus_contig9848:150..2432- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9848:150..2432- >mRNA_C-tenellus_contig9848.1.1 ID=mRNA_C-tenellus_contig9848.1.1|Name=mRNA_C-tenellus_contig9848.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=186bp|location=Sequence derived from alignment at C-tenellus_contig9848:150..2432- (Choristocarpus tenellus KU2346)back to top |