prot_C-tenellus_contig9695.1.2 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9695.1.2 vs. uniprot
Match: D8LNR1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNR1_ECTSI) HSP 1 Score: 94.4 bits (233), Expect = 4.820e-23 Identity = 43/71 (60.56%), Postives = 56/71 (78.87%), Query Frame = 0 Query: 1 MYGEVGAASYPVDVLSWDSVSGRASLRVLESTIVPVHAALTLVGSYEGLPCAMTVLGISPFLAGLACERFL 71 ++GEVG+ +YPVDVLSWD+VSG LRV ++VP+ AAL+ VGS +PCA+ V +SPFLAGLACER+L Sbjct: 79 LHGEVGSLAYPVDVLSWDAVSGEGRLRVPARSLVPIRAALSFVGSCGDVPCAIDVREVSPFLAGLACERYL 149
BLAST of mRNA_C-tenellus_contig9695.1.2 vs. uniprot
Match: UPI00145A102D (ribonuclease P protein subunit p14-like isoform X1 n=4 Tax=Acipenseroidei TaxID=186622 RepID=UPI00145A102D) HSP 1 Score: 60.5 bits (145), Expect = 9.090e-10 Identity = 30/66 (45.45%), Postives = 45/66 (68.18%), Query Frame = 0 Query: 1 MYGEVGAASYPVDVLSWDSVSGRASLRVLESTIVPVHAALTLVGSYEGLPCAMTVLGISPFLAGLA 66 +YGE+GAA P DVL ++ + A LRV S +V + +ALTL+G Y+G PC + V+ ++PFL L+ Sbjct: 80 LYGEIGAA-LPFDVLKFEENTLSAVLRVYSSALVRLWSALTLLGGYQGQPCGVRVVQVTPFLLALS 144
BLAST of mRNA_C-tenellus_contig9695.1.2 vs. uniprot
Match: A0A8J5B2R9_9DIPT (Uncharacterized protein n=1 Tax=Bradysia odoriphaga TaxID=1564500 RepID=A0A8J5B2R9_9DIPT) HSP 1 Score: 50.1 bits (118), Expect = 3.860e-6 Identity = 27/65 (41.54%), Postives = 40/65 (61.54%), Query Frame = 0 Query: 1 MYGEVGAASYPVDVLSWDSVSGRASLRVLESTIVPVHAALTLVGSYEGLPCAMTVLGISPFLAGL 65 ++GE+G + VD+L +D + RA LRV S V + AALTL+ S++ +PC + V SP L L Sbjct: 36 VFGEIGGHT-TVDILKFDQNNQRAILRVPSSYYVKLRAALTLISSFQEIPCCIKVNTASPVLLSL 99 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9695.1.2 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9695.1.2 ID=prot_C-tenellus_contig9695.1.2|Name=mRNA_C-tenellus_contig9695.1.2|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=72bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|