prot_C-tenellus_contig9356.1.3 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9356.1.3 vs. uniprot
Match: A0A6H5JJK0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJK0_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 5.210e-6 Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 0 Query: 239 GNVDEAEPLFRQGIDELESALGPDHPDVAAVLSHLAALLND---------------------QGRNREARGLLERALATVERVYGPSHPVAVQ 310 G EAEPL+R+ + E+ALGP+HP +A L++ A LL++ QG+ EA L ER+LA E+V GP HP Q Sbjct: 736 GKFAEAEPLYRRATEIWETALGPEHPQMATALNNRAGLLSNVPPHSLSSFHSSNTHHVFITFQGKYEEAGPLYERSLAIREKVLGPDHPDVAQ 828
BLAST of mRNA_C-tenellus_contig9356.1.3 vs. uniprot
Match: A0A6H5K5H9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5H9_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 1.400e-5 Identity = 37/97 (38.14%), Postives = 48/97 (49.48%), Query Frame = 0 Query: 236 ILSGNVDEAEPLFRQGIDELESALGPDHPDVAAVLSHLAALLNDQ---------------GRNREARGLLERALATVERVYGPSH-PVAVQLRTVLG 316 + G EAEPL+ + E+ALGP+HP+VA L++ A LL DQ G+ EA L +LA E+VYGP H VA L G Sbjct: 28 VSQGKYAEAEPLYERWQAIFETALGPEHPNVATALNNRAGLLEDQRRQTNFSPPLPVTFQGKYEEAEPLYMLSLAIDEKVYGPDHLEVAEDLNNCAG 124 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9356.1.3 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9356.1.3 ID=prot_C-tenellus_contig9356.1.3|Name=mRNA_C-tenellus_contig9356.1.3|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=324bpback to top |